BP917510
Clone id YMU001_000101_G02
Library
Length 249
Definition Adiantum capillus-veneris mRNA. clone: YMU001_000101_G02.
Accession
Tissue type prothallium
Developmental stage -
Contig ID
Sequence
ACAATCCTCATTCAAGAAGTGAGGCAAACAGATCGCCAATGCACTCACAATTGTTGCACA
GCAAAACCCACATTCTCGACGATTGTTAGCTTGGGAAAAAACAACTTTTTTGCTTCGACG
TTCCAAACCATCCCTTTCACAGCAAGGGTAATGGACTCAATTCTCTACAAAGATGCCACT
TGTCCTTCACAGCTGCATGGGCCTTTCCTCTTAATGAGTGGCATTATTACCTCCAAGAAA
TACACTCTC
■■Homology search results ■■ -
sp_hit_id A3QP00
Definition sp|A3QP00|TS1R2_PONPY Taste receptor type 1 member 2 OS=Pongo pygmaeus
Align length 69
Score (bit) 30.4
E-value 2.8
Report
BLASTX 2.2.19 [Nov-02-2008]


Reference: Altschul, Stephen F., Thomas L. Madden, Alejandro A. Schaffer,
Jinghui Zhang, Zheng Zhang, Webb Miller, and David J. Lipman (1997),
"Gapped BLAST and PSI-BLAST: a new generation of protein database search
programs", Nucleic Acids Res. 25:3389-3402.

Query= BP917510|Adiantum capillus-veneris mRNA, clone:
YMU001_000101_G02.
(249 letters)

Database: uniprot_sprot.fasta
412,525 sequences; 148,809,765 total letters

Searching..................................................done



Score E
Sequences producing significant alignments: (bits) Value

sp|A3QP00|TS1R2_PONPY Taste receptor type 1 member 2 OS=Pongo py... 30 2.8
sp|Q54JJ6|U663_DICDI UPF0663 protein OS=Dictyostelium discoideum... 29 8.3
sp|P55114|NAS33_CAEEL Zinc metalloproteinase nas-33 OS=Caenorhab... 29 8.3

>sp|A3QP00|TS1R2_PONPY Taste receptor type 1 member 2 OS=Pongo
pygmaeus GN=TAS1R2 PE=3 SV=1
Length = 839

Score = 30.4 bits (67), Expect = 2.8
Identities = 20/69 (28%), Positives = 32/69 (46%), Gaps = 1/69 (1%)
Frame = +1

Query: 22 RQTDRQCTHNCCTAKPTFSTIVSLGKNNFFASTFQTIPFTARVMDSILYKD-ATCPSQLH 198
R T Q NC A +F+TI+ L S + + A + S+L D +TC ++
Sbjct: 356 RSTCNQECDNCLNATLSFNTILRLSGERVVYSVYSAVYAVAHALHSLLGCDHSTCTKRVV 415

Query: 199 GPFLLMSGI 225
P+ L+ I
Sbjct: 416 YPWQLLEEI 424


>sp|Q54JJ6|U663_DICDI UPF0663 protein OS=Dictyostelium discoideum
GN=DDB_G0288009 PE=3 SV=1
Length = 905

Score = 28.9 bits (63), Expect = 8.3
Identities = 15/51 (29%), Positives = 25/51 (49%)
Frame = +1

Query: 13 QEVRQTDRQCTHNCCTAKPTFSTIVSLGKNNFFASTFQTIPFTARVMDSIL 165
+E + D++ T T +T + NN S+F T P ++MDS+L
Sbjct: 180 EEKKDEDKKENKTTTTTTTTNTTNNTNNNNNSDESSFDTTPLAVKLMDSLL 230


>sp|P55114|NAS33_CAEEL Zinc metalloproteinase nas-33
OS=Caenorhabditis elegans GN=nas-33 PE=2 SV=2
Length = 644

Score = 28.9 bits (63), Expect = 8.3
Identities = 15/44 (34%), Positives = 25/44 (56%), Gaps = 2/44 (4%)
Frame = -1

Query: 147 PCCERDGLERRSKKVVFSQANNR--RECGFCCATIVSALAICLP 22
PC + G R + V+ +Q ++R R G+CCA V + +C+P
Sbjct: 594 PCAQ--GTTRGKRSVLQTQISHRVKRLNGWCCARFVLSRGVCVP 635


tr_hit_id B6IKF5
Definition tr|B6IKF5|B6IKF5_CAEBR Putative uncharacterized protein OS=Caenorhabditis briggsae
Align length 51
Score (bit) 33.1
E-value 7.2
Report
BLASTX 2.2.19 [Nov-02-2008]


Reference: Altschul, Stephen F., Thomas L. Madden, Alejandro A. Schaffer,
Jinghui Zhang, Zheng Zhang, Webb Miller, and David J. Lipman (1997),
"Gapped BLAST and PSI-BLAST: a new generation of protein database search
programs", Nucleic Acids Res. 25:3389-3402.

Query= BP917510|Adiantum capillus-veneris mRNA, clone:
YMU001_000101_G02.
(249 letters)

Database: uniprot_trembl.fasta
7,341,751 sequences; 2,391,615,440 total letters

Searching..................................................done



Score E
Sequences producing significant alignments: (bits) Value

tr|B6IKF5|B6IKF5_CAEBR Putative uncharacterized protein OS=Caeno... 33 7.2

>tr|B6IKF5|B6IKF5_CAEBR Putative uncharacterized protein
OS=Caenorhabditis briggsae GN=CBG27585 PE=4 SV=1
Length = 230

Score = 33.1 bits (74), Expect = 7.2
Identities = 19/51 (37%), Positives = 29/51 (56%), Gaps = 3/51 (5%)
Frame = +1

Query: 58 TAKPTFSTIVSLGKNNFFASTFQTIPFTARVMDSILYKDAT---CPSQLHG 201
T + ST +SL KN+ AST +TIP R M+++ DA+ C + + G
Sbjct: 106 TVESEISTTISLIKNSASASTEKTIPENPRTMEALTIPDASRIICSADMGG 156