BP917524
Clone id YMU001_000101_H09
Library
Length 508
Definition Adiantum capillus-veneris mRNA. clone: YMU001_000101_H09.
Accession
Tissue type prothallium
Developmental stage -
Contig ID -
Sequence
AAGTGCTGGGTATGCATTGCATGGCAACACAAATATGGCCAAGGACTGCTTTTACTACAT
GGAGAAGCAAGGCTTGCATCTCAATGAAGCAGTGTTCACAAACATACTTGTGGCGTTTAC
ACATGCTGGGTTACTTGAGGAAGGCTGCAAATTGTTTAGTTCGGTGTTGCGATGTCATTC
CGAATTTTTAAATGCAATACACTATAGCTGCATTACGGACCTTTTTGGCAGGGTTGGACA
GCTAGATGATGCAGAGTCCTTCCTCCAAAGTATGCCTCTCTCACCCCGTACTTCCAGTCA
GACGTCTCTTCTTGCTAACTGTCGAATGCATGGCAATGCTGGGCTAGGAATGCAAACTTT
CAACTACTATGTTGAAGCTGATTTATCGGTGGCTTGTGGATGAGTTATTTTATTGATTTC
TCATCCTCTTCCTGTATGGTGTGTTTTTCACAAACTTATTGGGATGATGCTCTCTGTACA
ACTATTACAGCAGATGATCAACCCGTGG
■■Homology search results ■■ -
sp_hit_id Q9FI80
Definition sp|Q9FI80|PP425_ARATH Pentatricopeptide repeat-containing protein At5g48910 OS=Arabidopsis thaliana
Align length 123
Score (bit) 96.3
E-value 7.0e-20
Report
BLASTX 2.2.19 [Nov-02-2008]


Reference: Altschul, Stephen F., Thomas L. Madden, Alejandro A. Schaffer,
Jinghui Zhang, Zheng Zhang, Webb Miller, and David J. Lipman (1997),
"Gapped BLAST and PSI-BLAST: a new generation of protein database search
programs", Nucleic Acids Res. 25:3389-3402.

Query= BP917524|Adiantum capillus-veneris mRNA, clone:
YMU001_000101_H09.
(508 letters)

Database: uniprot_sprot.fasta
412,525 sequences; 148,809,765 total letters

Searching..................................................done



Score E
Sequences producing significant alignments: (bits) Value

sp|Q9FI80|PP425_ARATH Pentatricopeptide repeat-containing protei... 96 7e-20
sp|Q9FLZ9|PP405_ARATH Pentatricopeptide repeat-containing protei... 94 3e-19
sp|Q9FJY7|PP449_ARATH Pentatricopeptide repeat-containing protei... 93 8e-19
sp|P0C898|PP232_ARATH Putative pentatricopeptide repeat-containi... 87 5e-17
sp|O82380|PP175_ARATH Pentatricopeptide repeat-containing protei... 87 5e-17
sp|Q9LND4|PPR14_ARATH Pentatricopeptide repeat-containing protei... 86 8e-17
sp|Q9LZ19|PP364_ARATH Pentatricopeptide repeat-containing protei... 86 1e-16
sp|Q9ZVF4|PP140_ARATH Pentatricopeptide repeat-containing protei... 85 2e-16
sp|Q9ZVG8|PPR60_ARATH Pentatricopeptide repeat-containing protei... 84 3e-16
sp|Q8S9M4|PP198_ARATH Pentatricopeptide repeat-containing protei... 84 3e-16
sp|Q9LUJ2|PP249_ARATH Pentatricopeptide repeat-containing protei... 84 4e-16
sp|Q9CAY1|PP223_ARATH Putative pentatricopeptide repeat-containi... 84 4e-16
sp|Q3E9N1|PP359_ARATH Pentatricopeptide repeat-containing protei... 84 5e-16
sp|Q9LS72|PP261_ARATH Pentatricopeptide repeat-containing protei... 84 5e-16
sp|Q9SUH6|PP341_ARATH Pentatricopeptide repeat-containing protei... 83 7e-16
sp|Q9MA50|PPR13_ARATH Pentatricopeptide repeat-containing protei... 82 1e-15
sp|Q9SY02|PP301_ARATH Pentatricopeptide repeat-containing protei... 82 1e-15
sp|Q9SX45|PPR75_ARATH Pentatricopeptide repeat-containing protei... 82 1e-15
sp|Q9FIF7|PP435_ARATH Putative pentatricopeptide repeat-containi... 82 1e-15
sp|Q9LW63|PP251_ARATH Putative pentatricopeptide repeat-containi... 81 2e-15
sp|Q9SHZ8|PP168_ARATH Pentatricopeptide repeat-containing protei... 81 2e-15
sp|Q9FNN9|PP370_ARATH Putative pentatricopeptide repeat-containi... 81 3e-15
sp|Q9CA73|PP119_ARATH Putative pentatricopeptide repeat-containi... 81 3e-15
sp|Q1PFQ9|PPR62_ARATH Pentatricopeptide repeat-containing protei... 80 4e-15
sp|Q9M2Y7|PP274_ARATH Pentatricopeptide repeat-containing protei... 80 4e-15
sp|Q9LNP2|PPR47_ARATH Putative pentatricopeptide repeat-containi... 80 6e-15
sp|O23266|PP308_ARATH Pentatricopeptide repeat-containing protei... 80 6e-15
sp|Q9LTV8|PP224_ARATH Pentatricopeptide repeat-containing protei... 80 6e-15
sp|Q9SS97|PP205_ARATH Putative pentatricopeptide repeat-containi... 80 6e-15
sp|Q3ECB8|PP128_ARATH Pentatricopeptide repeat-containing protei... 80 6e-15

>sp|Q9FI80|PP425_ARATH Pentatricopeptide repeat-containing protein
At5g48910 OS=Arabidopsis thaliana GN=PCMP-H38 PE=2 SV=1
Length = 646

Score = 96.3 bits (238), Expect = 7e-20
Identities = 46/123 (37%), Positives = 69/123 (56%)
Frame = +2

Query: 8 GYALHGNTNMAKDCFYYMEKQGLHLNEAVFTNILVAFTHAGLLEEGCKLFSSVLRCHSEF 187
G+A+HG A DCF M + G+ ++ + N+L A +H GL+EEG + FS ++
Sbjct: 349 GFAIHGQAGDAIDCFCKMRQAGVRPSDVAYINLLTACSHGGLVEEGRRYFSQMVSVDGLE 408

Query: 188 LNAIHYSCITDLFGRVGQLDDAESFLQSMPLSPRTSSQTSLLANCRMHGNAGLGMQTFNY 367
HY C+ DL GR G LD+AE F+ +MP+ P +LL CRM GN +G + N
Sbjct: 409 PRIEHYGCMVDLLGRSGLLDEAEEFILNMPIKPDDVIWKALLGACRMQGNVEMGKRVANI 468

Query: 368 YVE 376
++
Sbjct: 469 LMD 471


>sp|Q9FLZ9|PP405_ARATH Pentatricopeptide repeat-containing protein
At5g39350 OS=Arabidopsis thaliana GN=PCMP-E16 PE=2 SV=1
Length = 677

Score = 94.4 bits (233), Expect = 3e-19
Identities = 57/161 (35%), Positives = 84/161 (52%), Gaps = 1/161 (0%)
Frame = +2

Query: 5 AGYALHGNTNMAKDCFYYMEKQGLHLNEAVFTNILVAFTHAGLLEEGCKLFSSVLRCHSE 184
+GY +HG+ + A F M + G+ NE FT+ L A +H+GL+EEG LF +L +
Sbjct: 498 SGYGMHGDGHNALQVFMEMVRSGVTPNEITFTSALNACSHSGLVEEGLTLFRFMLEHYKT 557

Query: 185 FLNAIHYSCITDLFGRVGQLDDAESFLQSMPLSPRTSSQTSLLANCRMHGNAGLGMQTFN 364
+ HY+CI DL GR G+LD+A + + ++P P ++ +LLA C H N LG N
Sbjct: 558 LARSNHYTCIVDLLGRAGRLDEAYNLITTIPFEPTSTVWGALLAACVTHENVQLGEMAAN 617

Query: 365 YYVEADLSVACG*VILL-ISHPLPVWCVFHKLIGMMLSVQL 484
E + V+L I L W K+ MM +V L
Sbjct: 618 KLFELEPENTGNYVLLANIYAALGRWKDMEKVRSMMENVGL 658


>sp|Q9FJY7|PP449_ARATH Pentatricopeptide repeat-containing protein
At5g66520 OS=Arabidopsis thaliana GN=PCMP-H61 PE=2 SV=1
Length = 620

Score = 92.8 bits (229), Expect = 8e-19
Identities = 50/126 (39%), Positives = 69/126 (54%)
Frame = +2

Query: 5 AGYALHGNTNMAKDCFYYMEKQGLHLNEAVFTNILVAFTHAGLLEEGCKLFSSVLRCHSE 184
+GYA HG+ A F M+K G+ N FT +L A ++ GL+EEG +F S+ R ++
Sbjct: 321 SGYAYHGHGREAISKFMEMQKMGIKPNVITFTAVLTACSYTGLVEEGKLIFYSMERDYNL 380

Query: 185 FLNAIHYSCITDLFGRVGQLDDAESFLQSMPLSPRTSSQTSLLANCRMHGNAGLGMQTFN 364
HY CI DL GR G LD+A+ F+Q MPL P +LL CR+H N LG +
Sbjct: 381 KPTIEHYGCIVDLLGRAGLLDEAKRFIQEMPLKPNAVIWGALLKACRIHKNIELGEEIGE 440

Query: 365 YYVEAD 382
+ D
Sbjct: 441 ILIAID 446


>sp|P0C898|PP232_ARATH Putative pentatricopeptide repeat-containing
protein At3g15130 OS=Arabidopsis thaliana GN=PCMP-H86
PE=3 SV=1
Length = 689

Score = 87.0 bits (214), Expect = 5e-17
Identities = 41/125 (32%), Positives = 68/125 (54%)
Frame = +2

Query: 8 GYALHGNTNMAKDCFYYMEKQGLHLNEAVFTNILVAFTHAGLLEEGCKLFSSVLRCHSEF 187
GY HG + FY M + + +E + +L A +H+G+++EG +LFS +L H
Sbjct: 388 GYGKHGLGKKSVRIFYEMLRHNIEPDEVCYLAVLSACSHSGMIKEGEELFSKLLETHGIK 447

Query: 188 LNAIHYSCITDLFGRVGQLDDAESFLQSMPLSPRTSSQTSLLANCRMHGNAGLGMQTFNY 367
HY+C+ DL GR G+L +A+ + +MP+ P +LL+ CR+HG+ LG +
Sbjct: 448 PRVEHYACVVDLLGRAGRLKEAKHLIDTMPIKPNVGIWQTLLSLCRVHGDIELGKEVGKI 507

Query: 368 YVEAD 382
+ D
Sbjct: 508 LLRID 512



Score = 41.6 bits (96), Expect = 0.002
Identities = 29/127 (22%), Positives = 61/127 (48%)
Frame = +2

Query: 5 AGYALHGNTNMAKDCFYYMEKQGLHLNEAVFTNILVAFTHAGLLEEGCKLFSSVLRCHSE 184
+G+ L+G+ + F M +QG++ NE F+ L A LE+G ++ L+ E
Sbjct: 80 SGHVLNGDLKGSLSLFSEMGRQGIYPNEFTFSTNLKACGLLNALEKGLQIHGFCLKIGFE 139

Query: 185 FLNAIHYSCITDLFGRVGQLDDAESFLQSMPLSPRTSSQTSLLANCRMHGNAGLGMQTFN 364
+ + S + D++ + G++++AE + + + S +++A G + TF
Sbjct: 140 MMVEVGNS-LVDMYSKCGRINEAEKVFRRI-VDRSLISWNAMIAGFVHAGYGSKALDTFG 197

Query: 365 YYVEADL 385
EA++
Sbjct: 198 MMQEANI 204


>sp|O82380|PP175_ARATH Pentatricopeptide repeat-containing protein
At2g29760, chloroplastic OS=Arabidopsis thaliana
GN=PCMP-H33 PE=2 SV=1
Length = 738

Score = 87.0 bits (214), Expect = 5e-17
Identities = 43/113 (38%), Positives = 63/113 (55%)
Frame = +2

Query: 8 GYALHGNTNMAKDCFYYMEKQGLHLNEAVFTNILVAFTHAGLLEEGCKLFSSVLRCHSEF 187
G A+HG N A D FY M++ + N FTN+ A +H GL++E LF + +
Sbjct: 440 GLAMHGCGNEAVDMFYKMQEANVKPNGVTFTNVFCACSHTGLVDEAESLFHQMESNYGIV 499

Query: 188 LNAIHYSCITDLFGRVGQLDDAESFLQSMPLSPRTSSQTSLLANCRMHGNAGL 346
HY+CI D+ GR G L+ A F+++MP+ P TS +LL C++H N L
Sbjct: 500 PEEKHYACIVDVLGRSGYLEKAVKFIEAMPIPPSTSVWGALLGACKIHANLNL 552


>sp|Q9LND4|PPR14_ARATH Pentatricopeptide repeat-containing protein
At1g06140, mitochondrial OS=Arabidopsis thaliana
GN=PCMP-E61 PE=2 SV=1
Length = 558

Score = 86.3 bits (212), Expect = 8e-17
Identities = 40/112 (35%), Positives = 67/112 (59%)
Frame = +2

Query: 11 YALHGNTNMAKDCFYYMEKQGLHLNEAVFTNILVAFTHAGLLEEGCKLFSSVLRCHSEFL 190
+ ++G A DCF+ M+ Q + N F ++L A +H+G ++EG K F S+ R +
Sbjct: 388 FGINGLFEEALDCFHKMKSQNVVPNSVTFVSLLSACSHSGNVKEGWKQFESMTRDYGVVP 447

Query: 191 NAIHYSCITDLFGRVGQLDDAESFLQSMPLSPRTSSQTSLLANCRMHGNAGL 346
HY+C+ DL GR G++ +A+SF+ +MP+ P S+ +LL+ CR+H L
Sbjct: 448 EEEHYACMVDLLGRAGEIGEAKSFIDNMPVKPMASAWGALLSACRIHKEVDL 499



Score = 35.4 bits (80), Expect = 0.16
Identities = 22/91 (24%), Positives = 43/91 (47%)
Frame = +2

Query: 5 AGYALHGNTNMAKDCFYYMEKQGLHLNEAVFTNILVAFTHAGLLEEGCKLFSSVLRCHSE 184
+G+A A D F M ++ + N+ ILV+ + G L G + ++R E
Sbjct: 285 SGFAKCERAVEAFDLFRQMLRESILPNQCTLAAILVSCSSLGSLRHGKSVHGYMIRNGIE 344

Query: 185 FLNAIHYSCITDLFGRVGQLDDAESFLQSMP 277
++A++++ D++ R G + A + MP
Sbjct: 345 -MDAVNFTSFIDMYARCGNIQMARTVFDMMP 374



Score = 34.7 bits (78), Expect = 0.27
Identities = 27/116 (23%), Positives = 52/116 (44%), Gaps = 3/116 (2%)
Frame = +2

Query: 23 GNTNMAKDCFYYMEKQGLHLNEAVFTNILVAFTHAGLLEEGCKLFSSVLRCHSEFLNAIH 202
G+ K YM + G+ ++ FT+ + + G ++ +F + N I
Sbjct: 326 GSLRHGKSVHGYMIRNGIEMDAVNFTSFIDMYARCGNIQMARTVFDMMPE-----RNVIS 380

Query: 203 YSCITDLFGRVGQLDDA-ESF--LQSMPLSPRTSSQTSLLANCRMHGNAGLGMQTF 361
+S + + FG G ++A + F ++S + P + + SLL+ C GN G + F
Sbjct: 381 WSSMINAFGINGLFEEALDCFHKMKSQNVVPNSVTFVSLLSACSHSGNVKEGWKQF 436


>sp|Q9LZ19|PP364_ARATH Pentatricopeptide repeat-containing protein
At5g04780 OS=Arabidopsis thaliana GN=PCMP-H16 PE=2 SV=2
Length = 635

Score = 85.5 bits (210), Expect = 1e-16
Identities = 41/114 (35%), Positives = 63/114 (55%)
Frame = +2

Query: 5 AGYALHGNTNMAKDCFYYMEKQGLHLNEAVFTNILVAFTHAGLLEEGCKLFSSVLRCHSE 184
+G+A H F M++ G+H NE F+++L H GL+EEG + F + +
Sbjct: 337 SGFAKHARPKEVMILFEKMQQDGMHPNEVTFSSLLSVCGHTGLVEEGRRFFKLMRTTYGL 396

Query: 185 FLNAIHYSCITDLFGRVGQLDDAESFLQSMPLSPRTSSQTSLLANCRMHGNAGL 346
N +HYSC+ D+ GR G L +A ++S+P P S SLLA+CR++ N L
Sbjct: 397 SPNVVHYSCMVDILGRAGLLSEAYELIKSIPFDPTASIWGSLLASCRVYKNLEL 450


>sp|Q9ZVF4|PP140_ARATH Pentatricopeptide repeat-containing protein
At2g01510, mitochondrial OS=Arabidopsis thaliana
GN=PCMP-H37 PE=2 SV=1
Length = 584

Score = 85.1 bits (209), Expect = 2e-16
Identities = 45/125 (36%), Positives = 72/125 (57%), Gaps = 2/125 (1%)
Frame = +2

Query: 8 GYALHGNTNMAKDCFYYMEKQGLHLNEAVFTNILVAFTHAGLLEEGCKLFSSVLRCHSEF 187
GYA++G++ A F M+ +GL N F +L A +HAGL+ EG + FS +++ + +
Sbjct: 285 GYAMNGDSREALTLFTTMQNEGLRPNYVTFLGVLSACSHAGLVNEGKRYFSLMVQSNDKN 344

Query: 188 LNAI--HYSCITDLFGRVGQLDDAESFLQSMPLSPRTSSQTSLLANCRMHGNAGLGMQTF 361
L HY+C+ DL GR G L++A F++ MP+ P T +LL C +H + LG +
Sbjct: 345 LEPRKEHYACMVDLLGRSGLLEEAYEFIKKMPVEPDTGIWGALLGACAVHRDMILGQKVA 404

Query: 362 NYYVE 376
+ VE
Sbjct: 405 DVLVE 409


>sp|Q9ZVG8|PPR60_ARATH Pentatricopeptide repeat-containing protein
At1g26900, mitochondrial OS=Arabidopsis thaliana
GN=PCMP-E54 PE=2 SV=1
Length = 572

Score = 84.3 bits (207), Expect = 3e-16
Identities = 42/117 (35%), Positives = 68/117 (58%), Gaps = 2/117 (1%)
Frame = +2

Query: 5 AGYALHGNTNMAKDCFYYMEKQGLHL--NEAVFTNILVAFTHAGLLEEGCKLFSSVLRCH 178
+GY HG A F ME++ + NE F +L A +H GL+ EG + F ++ +
Sbjct: 402 SGYGAHGLAREAVTLFNKMEEENCKVRPNEITFLVVLNACSHGGLVMEGIRCFKRMVEAY 461

Query: 179 SEFLNAIHYSCITDLFGRVGQLDDAESFLQSMPLSPRTSSQTSLLANCRMHGNAGLG 349
S HY C+ DL GR GQL++A ++++P++ +++ +LLA CR++GNA LG
Sbjct: 462 SFTPKVEHYGCVVDLLGRAGQLEEAYELIRNLPITSDSTAWRALLAACRVYGNADLG 518


>sp|Q8S9M4|PP198_ARATH Pentatricopeptide repeat-containing protein
At2g41080 OS=Arabidopsis thaliana GN=PCMP-H29 PE=2 SV=2
Length = 650

Score = 84.3 bits (207), Expect = 3e-16
Identities = 45/141 (31%), Positives = 76/141 (53%), Gaps = 1/141 (0%)
Frame = +2

Query: 5 AGYALHGNTNMAKDCFYYMEKQ-GLHLNEAVFTNILVAFTHAGLLEEGCKLFSSVLRCHS 181
+ Y HG + A + F M +Q + +NE F N+L A +H+GL ++G +LF ++ +
Sbjct: 351 SAYGFHGQGDEAIELFNTMAEQTNMEINEVAFLNLLYACSHSGLKDKGLELFDMMVEKYG 410

Query: 182 EFLNAIHYSCITDLFGRVGQLDDAESFLQSMPLSPRTSSQTSLLANCRMHGNAGLGMQTF 361
HY+C+ DL GR G LD AE+ ++SMP+ +LL+ C +H NA + + F
Sbjct: 411 FKPGLKHYTCVVDLLGRAGCLDQAEAIIRSMPIKTDIVIWKTLLSACNIHKNAEMAQRVF 470

Query: 362 NYYVEADLSVACG*VILLISH 424
++ D + + V+L H
Sbjct: 471 KEILQIDPNDSACYVLLANVH 491


tr_hit_id A7PGH4
Definition tr|A7PGH4|A7PGH4_VITVI Chromosome chr17 scaffold_16, whole genome shotgun sequence OS=Vitis vinifera
Align length 126
Score (bit) 105.0
E-value 2.0e-21
Report
BLASTX 2.2.19 [Nov-02-2008]


Reference: Altschul, Stephen F., Thomas L. Madden, Alejandro A. Schaffer,
Jinghui Zhang, Zheng Zhang, Webb Miller, and David J. Lipman (1997),
"Gapped BLAST and PSI-BLAST: a new generation of protein database search
programs", Nucleic Acids Res. 25:3389-3402.

Query= BP917524|Adiantum capillus-veneris mRNA, clone:
YMU001_000101_H09.
(508 letters)

Database: uniprot_trembl.fasta
7,341,751 sequences; 2,391,615,440 total letters

Searching..................................................done



Score E
Sequences producing significant alignments: (bits) Value

tr|A7PGH4|A7PGH4_VITVI Chromosome chr17 scaffold_16, whole genom... 105 2e-21
tr|A7PNH6|A7PNH6_VITVI Chromosome chr1 scaffold_22, whole genome... 98 2e-19
tr|A5CBT0|A5CBT0_VITVI Putative uncharacterized protein OS=Vitis... 98 2e-19
tr|A7QIJ2|A7QIJ2_VITVI Chromosome chr9 scaffold_104, whole genom... 97 4e-19
tr|A7QMS3|A7QMS3_VITVI Chromosome undetermined scaffold_127, who... 96 8e-19
tr|A7PX41|A7PX41_VITVI Chromosome chr12 scaffold_36, whole genom... 96 8e-19
tr|A5B4W3|A5B4W3_VITVI Putative uncharacterized protein OS=Vitis... 96 8e-19
tr|Q8GRU0|Q8GRU0_ORYSJ Os07g0113500 protein OS=Oryza sativa subs... 96 1e-18
tr|A2YHI6|A2YHI6_ORYSI Putative uncharacterized protein OS=Oryza... 96 1e-18
tr|A7NWP9|A7NWP9_VITVI Chromosome chr5 scaffold_2, whole genome ... 94 3e-18
tr|A5AN69|A5AN69_VITVI Putative uncharacterized protein OS=Vitis... 94 4e-18
tr|A7Q5S4|A7Q5S4_VITVI Chromosome chr14 scaffold_54, whole genom... 94 5e-18
tr|Q10K51|Q10K51_ORYSJ Pentatricopeptide, putative (Putative unc... 93 6e-18
tr|A7PGD4|A7PGD4_VITVI Chromosome chr6 scaffold_15, whole genome... 93 8e-18
tr|A7NVQ5|A7NVQ5_VITVI Chromosome chr18 scaffold_1, whole genome... 93 8e-18
tr|A5AJY4|A5AJY4_VITVI Putative uncharacterized protein OS=Vitis... 93 8e-18
tr|Q5Z4A4|Q5Z4A4_ORYSJ Os06g0314100 protein OS=Oryza sativa subs... 92 1e-17
tr|Q2HSJ6|Q2HSJ6_MEDTR Tetratricopeptide-like helical OS=Medicag... 92 1e-17
tr|A9P0W0|A9P0W0_PICSI Putative uncharacterized protein OS=Picea... 92 1e-17
tr|A7P9A6|A7P9A6_VITVI Chromosome chr3 scaffold_8, whole genome ... 92 1e-17
tr|A7P2H4|A7P2H4_VITVI Chromosome chr1 scaffold_5, whole genome ... 92 1e-17
tr|A5BGC7|A5BGC7_VITVI Putative uncharacterized protein OS=Vitis... 92 1e-17
tr|A2YC84|A2YC84_ORYSI Putative uncharacterized protein OS=Oryza... 92 1e-17
tr|Q6Z8F8|Q6Z8F8_ORYSJ Selenium-binding protein-like OS=Oryza sa... 91 2e-17
tr|A7P4F3|A7P4F3_VITVI Chromosome chr4 scaffold_6, whole genome ... 91 2e-17
tr|A3AAD8|A3AAD8_ORYSJ Putative uncharacterized protein OS=Oryza... 91 2e-17
tr|A7QW88|A7QW88_VITVI Chromosome undetermined scaffold_200, who... 91 3e-17
tr|A5BYV5|A5BYV5_VITVI Putative uncharacterized protein OS=Vitis... 91 3e-17
tr|Q8W5J1|Q8W5J1_ORYSA Putative uncharacterized protein OSJNBb00... 91 4e-17
tr|Q7XD69|Q7XD69_ORYSJ Pentatricopeptide, putative, expressed OS... 91 4e-17

>tr|A7PGH4|A7PGH4_VITVI Chromosome chr17 scaffold_16, whole genome
shotgun sequence OS=Vitis vinifera GN=GSVIVT00017560001
PE=4 SV=1
Length = 988

Score = 105 bits (261), Expect = 2e-21
Identities = 50/126 (39%), Positives = 78/126 (61%)
Frame = +2

Query: 5 AGYALHGNTNMAKDCFYYMEKQGLHLNEAVFTNILVAFTHAGLLEEGCKLFSSVLRCHSE 184
AGY +HG A + F M + GL ++ FT IL+A +HAGL+E+G + F+ +L H+
Sbjct: 690 AGYGIHGRGKEALELFEKMLRLGLKPDDFTFTGILMACSHAGLVEDGLEYFNQMLNLHNI 749

Query: 185 FLNAIHYSCITDLFGRVGQLDDAESFLQSMPLSPRTSSQTSLLANCRMHGNAGLGMQTFN 364
HY+C+ D+ GR G++DDA ++ MP P + +SLL++CR+HGN GLG + N
Sbjct: 750 EPKLEHYTCVVDMLGRAGRIDDALRLIEEMPGDPDSRIWSSLLSSCRIHGNLGLGEKVAN 809

Query: 365 YYVEAD 382
+E +
Sbjct: 810 KLLELE 815


>tr|A7PNH6|A7PNH6_VITVI Chromosome chr1 scaffold_22, whole genome
shotgun sequence OS=Vitis vinifera GN=GSVIVT00021258001
PE=4 SV=1
Length = 563

Score = 98.2 bits (243), Expect = 2e-19
Identities = 49/126 (38%), Positives = 70/126 (55%)
Frame = +2

Query: 5 AGYALHGNTNMAKDCFYYMEKQGLHLNEAVFTNILVAFTHAGLLEEGCKLFSSVLRCHSE 184
+GYA+HG A + F M+ G+ N+ FT IL A +HAGL+ E LF S+ R H
Sbjct: 265 SGYAIHGRGREALEWFMKMQTAGVEPNQMTFTGILTACSHAGLVHEAKLLFESMERIHGF 324

Query: 185 FLNAIHYSCITDLFGRVGQLDDAESFLQSMPLSPRTSSQTSLLANCRMHGNAGLGMQTFN 364
+ HY C+ DL GR G L +AE +++MP+ P + +LL C +HGN LG Q
Sbjct: 325 KPSIEHYGCMVDLLGRAGLLKEAEELIENMPVKPNAAIWGALLNACHIHGNLELGKQIGK 384

Query: 365 YYVEAD 382
++ D
Sbjct: 385 ILIQVD 390


>tr|A5CBT0|A5CBT0_VITVI Putative uncharacterized protein OS=Vitis
vinifera GN=VITISV_030261 PE=4 SV=1
Length = 622

Score = 98.2 bits (243), Expect = 2e-19
Identities = 49/126 (38%), Positives = 70/126 (55%)
Frame = +2

Query: 5 AGYALHGNTNMAKDCFYYMEKQGLHLNEAVFTNILVAFTHAGLLEEGCKLFSSVLRCHSE 184
+GYA+HG A + F M+ G+ N+ FT IL A +HAGL+ E LF S+ R H
Sbjct: 324 SGYAIHGRGREALEWFMKMQTAGVEPNQMTFTGILTACSHAGLVHEAKLLFESMERIHGF 383

Query: 185 FLNAIHYSCITDLFGRVGQLDDAESFLQSMPLSPRTSSQTSLLANCRMHGNAGLGMQTFN 364
+ HY C+ DL GR G L +AE +++MP+ P + +LL C +HGN LG Q
Sbjct: 384 KPSIEHYGCMVDLLGRAGLLKEAEELIENMPVKPNAAIWGALLNACHIHGNLELGKQIGK 443

Query: 365 YYVEAD 382
++ D
Sbjct: 444 ILIQVD 449


>tr|A7QIJ2|A7QIJ2_VITVI Chromosome chr9 scaffold_104, whole genome
shotgun sequence OS=Vitis vinifera GN=GSVIVT00000282001
PE=4 SV=1
Length = 814

Score = 97.1 bits (240), Expect = 4e-19
Identities = 47/126 (37%), Positives = 75/126 (59%)
Frame = +2

Query: 5 AGYALHGNTNMAKDCFYYMEKQGLHLNEAVFTNILVAFTHAGLLEEGCKLFSSVLRCHSE 184
+GY+ HG + A + M K+G++ NE F IL A +H GL+EEG ++F+S+ ++
Sbjct: 513 SGYSKHGCSKEALILYEEMPKKGMYPNEVTFLAILSACSHTGLVEEGLRIFTSMQEDYNI 572

Query: 185 FLNAIHYSCITDLFGRVGQLDDAESFLQSMPLSPRTSSQTSLLANCRMHGNAGLGMQTFN 364
A HY+C+ DL GR G+L+DA+ F++ MP+ P S+ +LL CR+H + +G
Sbjct: 573 EAKAEHYTCMVDLLGRAGRLEDAKEFVEKMPIEPEVSTWGALLGACRVHKDMDMGRLAAQ 632

Query: 365 YYVEAD 382
E D
Sbjct: 633 RLFELD 638


>tr|A7QMS3|A7QMS3_VITVI Chromosome undetermined scaffold_127, whole
genome shotgun sequence OS=Vitis vinifera
GN=GSVIVT00002188001 PE=4 SV=1
Length = 801

Score = 96.3 bits (238), Expect = 8e-19
Identities = 48/114 (42%), Positives = 66/114 (57%)
Frame = +2

Query: 8 GYALHGNTNMAKDCFYYMEKQGLHLNEAVFTNILVAFTHAGLLEEGCKLFSSVLRCHSEF 187
G+A+HG A D F ME+QG+ N+ F +L A +HAGL+ EG KLF ++
Sbjct: 504 GFAMHGYGEEALDIFAEMERQGVKPNDITFIGLLHACSHAGLVTEGKKLFEKMVHTFGLV 563

Query: 188 LNAIHYSCITDLFGRVGQLDDAESFLQSMPLSPRTSSQTSLLANCRMHGNAGLG 349
HY C+ DL GR G LD+A ++SMP+ P T +L+A CR+H N LG
Sbjct: 564 PQIEHYGCMVDLLGRAGLLDEAHEMIKSMPIKPNTIVWGALVAACRLHKNPQLG 617


>tr|A7PX41|A7PX41_VITVI Chromosome chr12 scaffold_36, whole genome
shotgun sequence OS=Vitis vinifera GN=GSVIVT00025891001
PE=4 SV=1
Length = 676

Score = 96.3 bits (238), Expect = 8e-19
Identities = 49/125 (39%), Positives = 72/125 (57%)
Frame = +2

Query: 8 GYALHGNTNMAKDCFYYMEKQGLHLNEAVFTNILVAFTHAGLLEEGCKLFSSVLRCHSEF 187
G A++G A + F ME QG+ NE F IL A +H+ L++EGC F S+ +
Sbjct: 379 GLAINGQGKDALNLFSQMEMQGVKPNEVTFIGILNACSHSKLVDEGCSFFHSMTSIYGLK 438

Query: 188 LNAIHYSCITDLFGRVGQLDDAESFLQSMPLSPRTSSQTSLLANCRMHGNAGLGMQTFNY 367
NA H+ C+ DL+GR G LD A++ ++SMP P ++ +LL CR+HG+ LG Q
Sbjct: 439 PNAHHHCCMVDLYGRAGMLDQAQTVIKSMPFKPNSAIWGALLNACRIHGDTELGEQVGKR 498

Query: 368 YVEAD 382
+E D
Sbjct: 499 LLELD 503


>tr|A5B4W3|A5B4W3_VITVI Putative uncharacterized protein OS=Vitis
vinifera GN=VITISV_034275 PE=4 SV=1
Length = 771

Score = 96.3 bits (238), Expect = 8e-19
Identities = 48/114 (42%), Positives = 66/114 (57%)
Frame = +2

Query: 8 GYALHGNTNMAKDCFYYMEKQGLHLNEAVFTNILVAFTHAGLLEEGCKLFSSVLRCHSEF 187
G+A+HG A D F ME+QG+ N+ F +L A +HAGL+ EG KLF ++
Sbjct: 474 GFAMHGYGEEALDIFAEMERQGVKPNDITFIGLLHACSHAGLVTEGKKLFEKMVHTFGLV 533

Query: 188 LNAIHYSCITDLFGRVGQLDDAESFLQSMPLSPRTSSQTSLLANCRMHGNAGLG 349
HY C+ DL GR G LD+A ++SMP+ P T +L+A CR+H N LG
Sbjct: 534 PQIEHYGCMVDLLGRAGLLDEAHEMIKSMPIKPNTIVWGALVAACRLHKNPQLG 587


>tr|Q8GRU0|Q8GRU0_ORYSJ Os07g0113500 protein OS=Oryza sativa subsp.
japonica GN=OJ1513_F02.122 PE=4 SV=1
Length = 634

Score = 95.5 bits (236), Expect = 1e-18
Identities = 48/127 (37%), Positives = 73/127 (57%)
Frame = +2

Query: 8 GYALHGNTNMAKDCFYYMEKQGLHLNEAVFTNILVAFTHAGLLEEGCKLFSSVLRCHSEF 187
GYA+HG++ A + F + QGL + F +L A +H+GL++EG + F S+ ++
Sbjct: 337 GYAMHGDSRKALEMFSQLRSQGLWPTDITFIGLLNACSHSGLVDEGHQFFQSMEEEYAIV 396

Query: 188 LNAIHYSCITDLFGRVGQLDDAESFLQSMPLSPRTSSQTSLLANCRMHGNAGLGMQTFNY 367
HY C+ DL GR G +++A +QSM ++P T SLLA CR+H N LG Q +Y
Sbjct: 397 PKIEHYGCMVDLLGRAGLIEEAFHLVQSMTIAPDTVMWVSLLAACRLHKNMALGQQIADY 456

Query: 368 YVEADLS 388
V L+
Sbjct: 457 LVAGGLA 463



Score = 43.5 bits (101), Expect = 0.006
Identities = 32/119 (26%), Positives = 51/119 (42%)
Frame = +2

Query: 8 GYALHGNTNMAKDCFYYMEKQGLHLNEAVFTNILVAFTHAGLLEEGCKLFSSVLRCHSEF 187
GY HG N A F +M + G+ +E L A G E G L S V
Sbjct: 235 GYTQHGRPNEALRLFRWMLRSGVDPDEVAIILALSAVAQLGTAESGRWLHSYVKNSRRVQ 294

Query: 188 LNAIHYSCITDLFGRVGQLDDAESFLQSMPLSPRTSSQTSLLANCRMHGNAGLGMQTFN 364
LNA + + D++ + G L+DA S S+ +++ MHG++ ++ F+
Sbjct: 295 LNARVGTALIDMYCKCGSLEDAVSVFNSIG-DKDIVVWNAMINGYAMHGDSRKALEMFS 352


>tr|A2YHI6|A2YHI6_ORYSI Putative uncharacterized protein OS=Oryza
sativa subsp. indica GN=OsI_24658 PE=4 SV=1
Length = 635

Score = 95.5 bits (236), Expect = 1e-18
Identities = 48/127 (37%), Positives = 73/127 (57%)
Frame = +2

Query: 8 GYALHGNTNMAKDCFYYMEKQGLHLNEAVFTNILVAFTHAGLLEEGCKLFSSVLRCHSEF 187
GYA+HG++ A + F + QGL + F +L A +H+GL++EG + F S+ ++
Sbjct: 338 GYAMHGDSRKALEMFSQLRSQGLWPTDITFIGLLNACSHSGLVDEGHQFFQSMEEEYAIV 397

Query: 188 LNAIHYSCITDLFGRVGQLDDAESFLQSMPLSPRTSSQTSLLANCRMHGNAGLGMQTFNY 367
HY C+ DL GR G +++A +QSM ++P T SLLA CR+H N LG Q +Y
Sbjct: 398 PKIEHYGCMVDLLGRAGLIEEAFHLVQSMTIAPDTVMWVSLLAACRLHKNMALGQQIADY 457

Query: 368 YVEADLS 388
V L+
Sbjct: 458 LVAGGLA 464



Score = 43.5 bits (101), Expect = 0.006
Identities = 32/119 (26%), Positives = 51/119 (42%)
Frame = +2

Query: 8 GYALHGNTNMAKDCFYYMEKQGLHLNEAVFTNILVAFTHAGLLEEGCKLFSSVLRCHSEF 187
GY HG N A F +M + G+ +E L A G E G L S V
Sbjct: 236 GYTQHGRPNEALRLFRWMLRSGVDPDEVAIILALSAVAQLGTAESGRWLHSYVKNSRRVQ 295

Query: 188 LNAIHYSCITDLFGRVGQLDDAESFLQSMPLSPRTSSQTSLLANCRMHGNAGLGMQTFN 364
LNA + + D++ + G L+DA S S+ +++ MHG++ ++ F+
Sbjct: 296 LNARVGTALIDMYCKCGSLEDAVSVFNSIG-DKDIVVWNAMINGYAMHGDSRKALEMFS 353


>tr|A7NWP9|A7NWP9_VITVI Chromosome chr5 scaffold_2, whole genome
shotgun sequence OS=Vitis vinifera GN=GSVIVT00020010001
PE=4 SV=1
Length = 727

Score = 94.4 bits (233), Expect = 3e-18
Identities = 47/126 (37%), Positives = 71/126 (56%)
Frame = +2

Query: 5 AGYALHGNTNMAKDCFYYMEKQGLHLNEAVFTNILVAFTHAGLLEEGCKLFSSVLRCHSE 184
+ +A+HG+ A F+ ME + + N F +L A +HAGL+EEG K+F S++ H+
Sbjct: 429 SAFAMHGDAGSALRFFHQMEDENIEPNGITFVGVLYACSHAGLVEEGRKIFYSMINEHNI 488

Query: 185 FLNAIHYSCITDLFGRVGQLDDAESFLQSMPLSPRTSSQTSLLANCRMHGNAGLGMQTFN 364
+HY C+ DLFGR L +A +++MPL+P SL+A CR+HG LG
Sbjct: 489 TPKHVHYGCMVDLFGRANLLREALELVEAMPLAPNVIIWGSLMAACRVHGEIELGEFAAK 548

Query: 365 YYVEAD 382
+E D
Sbjct: 549 RLLELD 554



Score = 38.1 bits (87), Expect = 0.25
Identities = 27/121 (22%), Positives = 57/121 (47%), Gaps = 1/121 (0%)
Frame = +2

Query: 5 AGYALHGNTNMAKDCFYYMEKQGLHLNEAVFTNILVAFTHAGLLEEGCKLFSSVLRCHSE 184
+GYA + A + F M+ G+ ++ +++ A H G L++ + V + +
Sbjct: 328 SGYAESDSPQEALNLFNEMQSLGIKPDQVTMLSVITACAHLGALDQAKWIHLFVDK--NG 385

Query: 185 FLNAIHY-SCITDLFGRVGQLDDAESFLQSMPLSPRTSSQTSLLANCRMHGNAGLGMQTF 361
F A+ + + +++ + G L+ A MP S T +++ MHG+AG ++ F
Sbjct: 386 FGGALPINNALIEMYAKCGSLERARRIFDKMP-RKNVISWTCMISAFAMHGDAGSALRFF 444

Query: 362 N 364
+
Sbjct: 445 H 445