BP917530
Clone id YMU001_000102_A05
Library
Length 390
Definition Adiantum capillus-veneris mRNA. clone: YMU001_000102_A05.
Accession
Tissue type prothallium
Developmental stage -
Contig ID
Sequence
CTGCAGGTAACACAAGCGAGATCCTCGCTGCGCCGGGTCCCTCTTTTGGGCAAGACAGCG
AGATGGATAAATCTATCCCCCTTTGGGCAATTAGCTTCGTTGGTAGAGTGCCTGTCAAAT
ACAAAGGGTAGAACAATGTGAAGCATCCCACACTACATTGCTTACCACTGGCTCAGAAAC
ACATTCTAGCCGTCTGTAGCAACCGATTATCCAGTTTTAACAGCCGATATGACAGAGGAG
AGCGCCTCAACTCGACAAAACAAAATGACATGGTGCAGTGTTGTGGCTTATTGCTGCTGC
CGTAGAATTGATAGAACTGCTTCAAACTACCTTTAATCACCAGGAGCAAGAGGAAGAAGA
AGAAGATGATGATGACAGTCATCATGATGA
■■Homology search results ■■ -
sp_hit_id O60431
Definition sp|O60431|OR1I1_HUMAN Olfactory receptor 1I1 OS=Homo sapiens
Align length 36
Score (bit) 29.3
E-value 6.4
Report
BLASTX 2.2.19 [Nov-02-2008]


Reference: Altschul, Stephen F., Thomas L. Madden, Alejandro A. Schaffer,
Jinghui Zhang, Zheng Zhang, Webb Miller, and David J. Lipman (1997),
"Gapped BLAST and PSI-BLAST: a new generation of protein database search
programs", Nucleic Acids Res. 25:3389-3402.

Query= BP917530|Adiantum capillus-veneris mRNA, clone:
YMU001_000102_A05.
(390 letters)

Database: uniprot_sprot.fasta
412,525 sequences; 148,809,765 total letters

Searching..................................................done



Score E
Sequences producing significant alignments: (bits) Value

sp|O60431|OR1I1_HUMAN Olfactory receptor 1I1 OS=Homo sapiens GN=... 29 6.4
sp|Q6AJ43|Y2908_DESPS UPF0082 protein DP2908 OS=Desulfotalea psy... 29 8.4

>sp|O60431|OR1I1_HUMAN Olfactory receptor 1I1 OS=Homo sapiens
GN=OR1I1 PE=2 SV=1
Length = 355

Score = 29.3 bits (64), Expect = 6.4
Identities = 13/36 (36%), Positives = 21/36 (58%)
Frame = -3

Query: 151 VGCFTLFYPLYLTGTLPTKLIAQRGIDLSISLSCPK 44
VGC T Y +L GT+ + L+A ID +++ P+
Sbjct: 95 VGCLTQMYAFHLFGTMDSFLLAVMAIDRFVAIVHPQ 130


>sp|Q6AJ43|Y2908_DESPS UPF0082 protein DP2908 OS=Desulfotalea
psychrophila GN=DP2908 PE=3 SV=1
Length = 250

Score = 28.9 bits (63), Expect = 8.4
Identities = 12/26 (46%), Positives = 18/26 (69%)
Frame = +1

Query: 85 GQLASLVECLSNTKGRTM*SIPHYIA 162
G +A LVEC+++ + RT+ I HY A
Sbjct: 93 GGVAVLVECMTDNRNRTVADIRHYFA 118


tr_hit_id A5B5E3
Definition tr|A5B5E3|A5B5E3_VITVI Putative uncharacterized protein OS=Vitis vinifera
Align length 63
Score (bit) 32.7
E-value 9.3
Report
BLASTX 2.2.19 [Nov-02-2008]


Reference: Altschul, Stephen F., Thomas L. Madden, Alejandro A. Schaffer,
Jinghui Zhang, Zheng Zhang, Webb Miller, and David J. Lipman (1997),
"Gapped BLAST and PSI-BLAST: a new generation of protein database search
programs", Nucleic Acids Res. 25:3389-3402.

Query= BP917530|Adiantum capillus-veneris mRNA, clone:
YMU001_000102_A05.
(390 letters)

Database: uniprot_trembl.fasta
7,341,751 sequences; 2,391,615,440 total letters

Searching..................................................done



Score E
Sequences producing significant alignments: (bits) Value

tr|A5B5E3|A5B5E3_VITVI Putative uncharacterized protein OS=Vitis... 33 9.3

>tr|A5B5E3|A5B5E3_VITVI Putative uncharacterized protein OS=Vitis
vinifera GN=VITISV_024219 PE=4 SV=1
Length = 578

Score = 32.7 bits (73), Expect = 9.3
Identities = 20/63 (31%), Positives = 34/63 (53%)
Frame = +1

Query: 61 RWINLSPFGQLASLVECLSNTKGRTM*SIPHYIAYHWLRNTF*PSVATDYPVLTADMTEE 240
R L+ F L S++E +SN R I ++++YH L +++ V+T PV + T E
Sbjct: 56 RLSKLANFPFLPSIIESMSNRSTRNPHPIYNFLSYHRLSSSYSAFVSTLSPVSFPNSTSE 115

Query: 241 SAS 249
+ S
Sbjct: 116 ALS 118