BP917542
Clone id YMU001_000102_B08
Library
Length 295
Definition Adiantum capillus-veneris mRNA. clone: YMU001_000102_B08.
Accession
Tissue type prothallium
Developmental stage -
Contig ID
Sequence
CCACAGCTATCTCTCCTTAGTAAAGCTCATGTCAAATTGTTGCAAGCTAAGTATCCACTT
TTGCAATTTAGGACTATCCCCAAGACACCTTAGTGCACGAGGCAATAAACTACATGATGT
CAACACCACAAAAGGCTTACAAATAAGATAGGATTTCAGCCTTTTTGTTGCATATACCAA
TGCCCAAACCAATTGCTCGATCTCATGCCAAGATTTTTGTTCATCATTCTTCACTTTGCT
TATGTAGTAAACCGGCCTCATATAAGATTGCTTTTTTCCTTTTTGCATCAATACT
■■Homology search results ■■ -
sp_hit_id P04323
Definition sp|P04323|POL3_DROME Retrovirus-related Pol polyprotein from transposon 17.6 OS=Drosophila melanogaster
Align length 75
Score (bit) 45.4
E-value 9.0e-05
Report
BLASTX 2.2.19 [Nov-02-2008]


Reference: Altschul, Stephen F., Thomas L. Madden, Alejandro A. Schaffer,
Jinghui Zhang, Zheng Zhang, Webb Miller, and David J. Lipman (1997),
"Gapped BLAST and PSI-BLAST: a new generation of protein database search
programs", Nucleic Acids Res. 25:3389-3402.

Query= BP917542|Adiantum capillus-veneris mRNA, clone:
YMU001_000102_B08.
(295 letters)

Database: uniprot_sprot.fasta
412,525 sequences; 148,809,765 total letters

Searching..................................................done



Score E
Sequences producing significant alignments: (bits) Value

sp|P04323|POL3_DROME Retrovirus-related Pol polyprotein from tra... 45 9e-05
sp|P20825|POL2_DROME Retrovirus-related Pol polyprotein from tra... 42 7e-04
sp|Q8I7P9|POL5_DROME Retrovirus-related Pol polyprotein from tra... 34 0.20
sp|P33042|VL03_VARV Protein L3 OS=Variola virus GN=L3L PE=3 SV=1 31 2.2
sp|P07614|VL03_VACCW Protein L3 OS=Vaccinia virus (strain Wester... 31 2.2
sp|P26810|POL_MLVF5 Pol polyprotein OS=Friend murine leukemia vi... 29 6.5
sp|P21031|VL03_VACCC Protein L3 OS=Vaccinia virus (strain Copenh... 29 8.5

>sp|P04323|POL3_DROME Retrovirus-related Pol polyprotein from
transposon 17.6 OS=Drosophila melanogaster GN=pol PE=4
SV=1
Length = 1058

Score = 45.4 bits (106), Expect = 9e-05
Identities = 23/75 (30%), Positives = 42/75 (56%)
Frame = -2

Query: 255 PVYYISKVKNDEQKSWHEIEQLVWALVYATKRLKSYLICKPFVVLTSCSLLPRALRCLGD 76
P+ YIS+ N+ + ++ IE+ + A+V+ATK + YL+ + F + + L R
Sbjct: 530 PLSYISRTLNEHEINYSTIEKELLAIVWATKTFRHYLLGRHFEISSDHQPLSWLYRMKDP 589

Query: 75 SPKLQKWILSLQQFD 31
+ KL +W + L +FD
Sbjct: 590 NSKLTRWRVKLSEFD 604


>sp|P20825|POL2_DROME Retrovirus-related Pol polyprotein from
transposon 297 OS=Drosophila melanogaster GN=pol PE=4
SV=1
Length = 1059

Score = 42.4 bits (98), Expect = 7e-04
Identities = 24/87 (27%), Positives = 45/87 (51%)
Frame = -2

Query: 294 VLMQKGKKQSYMRPVYYISKVKNDEQKSWHEIEQLVWALVYATKRLKSYLICKPFVVLTS 115
VL Q G P+ +IS+ ND + ++ IE+ + A+V+ATK + YL+ + F++ +
Sbjct: 522 VLSQNG------HPISFISRTLNDHELNYSAIEKELLAIVWATKTFRHYLLGRQFLIASD 575

Query: 114 CSLLPRALRCLGDSPKLQKWILSLQQF 34
L KL++W + L ++
Sbjct: 576 HQPLRWLHNLKEPGAKLERWRVRLSEY 602


>sp|Q8I7P9|POL5_DROME Retrovirus-related Pol polyprotein from
transposon opus OS=Drosophila melanogaster GN=pol PE=4
SV=1
Length = 1003

Score = 34.3 bits (77), Expect = 0.20
Identities = 20/77 (25%), Positives = 42/77 (54%), Gaps = 1/77 (1%)
Frame = -2

Query: 258 RPVYYISKVKNDEQKSWHEIEQLVWALVYATKRLKSYLI-CKPFVVLTSCSLLPRALRCL 82
RP+ YIS+ N ++++ IE+ + A++++ L++YL V T L AL
Sbjct: 459 RPIAYISRSLNKTEENYATIEKEMLAIIWSLDNLRAYLYGAGTIKVYTDHQPLTFALGNR 518

Query: 81 GDSPKLQKWILSLQQFD 31
+ KL++W +++++
Sbjct: 519 NFNAKLKRWKARIEEYN 535


>sp|P33042|VL03_VARV Protein L3 OS=Variola virus GN=L3L PE=3 SV=1
Length = 349

Score = 30.8 bits (68), Expect = 2.2
Identities = 25/82 (30%), Positives = 40/82 (48%), Gaps = 10/82 (12%)
Frame = -2

Query: 264 YMRPVYYISKVKNDEQKS-WHEIEQLV-------WALVYATKRLK--SYLICKPFVVLTS 115
Y+ P YY+ K +DE+ S W E+ LV + L+ A KR+ S L + F
Sbjct: 83 YLSPAYYMLKQVDDEEMSCWSELSSLVRSKKAVGFPLLKAAKRISHGSMLYFEQFKNSKV 142

Query: 114 CSLLPRALRCLGDSPKLQKWIL 49
L P+ ++CL D+ Q ++
Sbjct: 143 VRLTPQ-VKCLNDTVIFQTVVI 163


>sp|P07614|VL03_VACCW Protein L3 OS=Vaccinia virus (strain Western
Reserve) GN=F4 PE=3 SV=1
Length = 350

Score = 30.8 bits (68), Expect = 2.2
Identities = 25/82 (30%), Positives = 40/82 (48%), Gaps = 10/82 (12%)
Frame = -2

Query: 264 YMRPVYYISKVKNDEQKS-WHEIEQLV-------WALVYATKRLK--SYLICKPFVVLTS 115
Y+ P YY+ K +DE+ S W E+ LV + L+ A KR+ S L + F
Sbjct: 84 YLSPAYYMLKQVDDEEMSCWSELSSLVRSRKAVGFPLLKAAKRISHGSMLYFEQFKNSKV 143

Query: 114 CSLLPRALRCLGDSPKLQKWIL 49
L P+ ++CL D+ Q ++
Sbjct: 144 VRLTPQ-VKCLNDTVIFQTVVI 164


>sp|P26810|POL_MLVF5 Pol polyprotein OS=Friend murine leukemia virus
(isolate 57) GN=pol PE=3 SV=1
Length = 1204

Score = 29.3 bits (64), Expect = 6.5
Identities = 19/71 (26%), Positives = 32/71 (45%)
Frame = -2

Query: 264 YMRPVYYISKVKNDEQKSWHEIEQLVWALVYATKRLKSYLICKPFVVLTSCSLLPRALRC 85
+ RPV Y+SK + W ++V A+ TK + + +P V+L P A+
Sbjct: 513 WRRPVAYLSKKLDPVAAGWPPCLRMVAAIAVLTKDVGKLTMGQPLVILA-----PHAVEA 567

Query: 84 LGDSPKLQKWI 52
L P +W+
Sbjct: 568 LVKQPP-DRWL 577


>sp|P21031|VL03_VACCC Protein L3 OS=Vaccinia virus (strain
Copenhagen) GN=L3L PE=3 SV=1
Length = 350

Score = 28.9 bits (63), Expect = 8.5
Identities = 24/82 (29%), Positives = 39/82 (47%), Gaps = 10/82 (12%)
Frame = -2

Query: 264 YMRPVYYISKVKNDEQKS-WHEIEQLV-------WALVYATKRLK--SYLICKPFVVLTS 115
Y+ P YY+ K +DE+ S W E+ LV + L+ A KR+ S L +
Sbjct: 84 YLSPAYYMLKQVDDEEMSCWSELSSLVRSRKAVGFPLLKAAKRISHGSMLYFEQLKNSKV 143

Query: 114 CSLLPRALRCLGDSPKLQKWIL 49
L P+ ++CL D+ Q ++
Sbjct: 144 VKLTPQ-VKCLNDTVIFQTVVI 164


tr_hit_id B4MHZ6
Definition tr|B4MHZ6|B4MHZ6_DROWI GK21267 OS=Drosophila willistoni
Align length 87
Score (bit) 57.8
E-value 3.0e-07
Report
BLASTX 2.2.19 [Nov-02-2008]


Reference: Altschul, Stephen F., Thomas L. Madden, Alejandro A. Schaffer,
Jinghui Zhang, Zheng Zhang, Webb Miller, and David J. Lipman (1997),
"Gapped BLAST and PSI-BLAST: a new generation of protein database search
programs", Nucleic Acids Res. 25:3389-3402.

Query= BP917542|Adiantum capillus-veneris mRNA, clone:
YMU001_000102_B08.
(295 letters)

Database: uniprot_trembl.fasta
7,341,751 sequences; 2,391,615,440 total letters

Searching..................................................done



Score E
Sequences producing significant alignments: (bits) Value

tr|B4MHZ6|B4MHZ6_DROWI GK21267 OS=Drosophila willistoni GN=GK212... 58 3e-07
tr|B4NNU8|B4NNU8_DROWI GK19423 OS=Drosophila willistoni GN=GK194... 57 3e-07
tr|Q0ZCB7|Q0ZCB7_POPTR Integrase OS=Populus trichocarpa PE=2 SV=1 55 1e-06
tr|Q0ZCD0|Q0ZCD0_POPTR Integrase OS=Populus trichocarpa PE=2 SV=1 55 2e-06
tr|Q9SYC1|Q9SYC1_ARATH F11M15.5 protein OS=Arabidopsis thaliana ... 54 3e-06
tr|Q5W6Z3|Q5W6Z3_ORYSJ Putative polyprotein OS=Oryza sativa subs... 54 4e-06
tr|A5BDE4|A5BDE4_VITVI Putative uncharacterized protein OS=Vitis... 54 4e-06
tr|Q94885|Q94885_DROME Orf protein OS=Drosophila melanogaster GN... 54 4e-06
tr|Q7X8Z6|Q7X8Z6_ORYSJ OSJNBa0093P23.6 protein (OSJNBa0041M21.11... 54 5e-06
tr|Q01LU6|Q01LU6_ORYSA OSIGBa0136B09.5 protein OS=Oryza sativa G... 54 5e-06
tr|A5C0Q4|A5C0Q4_VITVI Putative uncharacterized protein OS=Vitis... 54 5e-06
tr|A5BID3|A5BID3_VITVI Putative uncharacterized protein OS=Vitis... 54 5e-06
tr|A5BGI1|A5BGI1_VITVI Putative uncharacterized protein OS=Vitis... 54 5e-06
tr|A5BG34|A5BG34_VITVI Putative uncharacterized protein OS=Vitis... 54 5e-06
tr|Q9SIX9|Q9SIX9_ARATH Putative retroelement gag/pol polyprotein... 53 7e-06
tr|Q0E0Q2|Q0E0Q2_ORYSJ Os02g0530800 protein OS=Oryza sativa subs... 53 7e-06
tr|A5B854|A5B854_VITVI Putative uncharacterized protein OS=Vitis... 53 7e-06
tr|A5AMT7|A5AMT7_VITVI Putative uncharacterized protein OS=Vitis... 53 7e-06
tr|A5AH70|A5AH70_VITVI Putative uncharacterized protein OS=Vitis... 53 7e-06
tr|A5C3J0|A5C3J0_VITVI Putative uncharacterized protein OS=Vitis... 53 9e-06
tr|A5BXQ2|A5BXQ2_VITVI Putative uncharacterized protein OS=Vitis... 53 9e-06
tr|A5BT86|A5BT86_VITVI Putative uncharacterized protein OS=Vitis... 53 9e-06
tr|A5B7S8|A5B7S8_VITVI Putative uncharacterized protein OS=Vitis... 53 9e-06
tr|Q2QXD9|Q2QXD9_ORYSJ Retrotransposon protein, putative, unclas... 52 1e-05
tr|A5C692|A5C692_VITVI Putative uncharacterized protein OS=Vitis... 52 1e-05
tr|A5BY14|A5BY14_VITVI Putative uncharacterized protein OS=Vitis... 52 1e-05
tr|A5BWF3|A5BWF3_VITVI Putative uncharacterized protein OS=Vitis... 52 1e-05
tr|A5BB70|A5BB70_VITVI Putative uncharacterized protein OS=Vitis... 52 1e-05
tr|A5B0C4|A5B0C4_VITVI Putative uncharacterized protein OS=Vitis... 52 1e-05
tr|A5AYT6|A5AYT6_VITVI Putative uncharacterized protein OS=Vitis... 52 1e-05

>tr|B4MHZ6|B4MHZ6_DROWI GK21267 OS=Drosophila willistoni GN=GK21267
PE=4 SV=1
Length = 1079

Score = 57.8 bits (138), Expect = 3e-07
Identities = 28/87 (32%), Positives = 48/87 (55%)
Frame = -2

Query: 291 LMQKGKKQSYMRPVYYISKVKNDEQKSWHEIEQLVWALVYATKRLKSYLICKPFVVLTSC 112
LMQ+ + M PV Y S+ + +H E A++YA +R + YL +PF+++T C
Sbjct: 718 LMQR-QTDGKMHPVSYYSRKATAAESRYHSFELETLAIIYAVRRFRVYLEHRPFLIVTDC 776

Query: 111 SLLPRALRCLGDSPKLQKWILSLQQFD 31
+ L + L +P++ +W L L+ FD
Sbjct: 777 NSLVQTLSKKSINPRIARWSLELENFD 803


>tr|B4NNU8|B4NNU8_DROWI GK19423 OS=Drosophila willistoni GN=GK19423
PE=4 SV=1
Length = 862

Score = 57.4 bits (137), Expect = 3e-07
Identities = 31/88 (35%), Positives = 49/88 (55%)
Frame = -2

Query: 294 VLMQKGKKQSYMRPVYYISKVKNDEQKSWHEIEQLVWALVYATKRLKSYLICKPFVVLTS 115
VL+QK + + PV Y SK+ + + H E A+VY+ KR ++YL PF ++T
Sbjct: 671 VLLQK-QTDGKLHPVSYFSKMASAAESKLHSYELETLAIVYSLKRFETYLKFIPFKIVTD 729

Query: 114 CSLLPRALRCLGDSPKLQKWILSLQQFD 31
C+ L LR G S K+ +W L L+ ++
Sbjct: 730 CNSLALTLRNGGHSAKIARWALLLENYN 757


>tr|Q0ZCB7|Q0ZCB7_POPTR Integrase OS=Populus trichocarpa PE=2 SV=1
Length = 1332

Score = 55.5 bits (132), Expect = 1e-06
Identities = 31/95 (32%), Positives = 54/95 (56%)
Frame = -2

Query: 294 VLMQKGKKQSYMRPVYYISKVKNDEQKSWHEIEQLVWALVYATKRLKSYLICKPFVVLTS 115
VL Q+ K+SY+ +YY SK N Q ++ ++ + A+V+A ++ +SYL+ P VV +
Sbjct: 634 VLGQRKDKKSYV--IYYASKTLNSSQMNYTTTKKELLAIVFACEKFRSYLVGSPVVVFSD 691

Query: 114 CSLLPRALRCLGDSPKLQKWILSLQQFDMSFTKER 10
+ L L +L WIL LQ+FD++ ++
Sbjct: 692 HAALKYLLSKKDSKDRLVWWILLLQEFDITIKDKK 726


>tr|Q0ZCD0|Q0ZCD0_POPTR Integrase OS=Populus trichocarpa PE=2 SV=1
Length = 1139

Score = 54.7 bits (130), Expect = 2e-06
Identities = 30/95 (31%), Positives = 54/95 (56%)
Frame = -2

Query: 294 VLMQKGKKQSYMRPVYYISKVKNDEQKSWHEIEQLVWALVYATKRLKSYLICKPFVVLTS 115
VL Q+ K+ Y+ +YY SK N Q ++ ++ + A+V+A ++ +SYL+ P VV +
Sbjct: 655 VLGQRKDKKPYV--IYYASKTLNSAQMNYTTTKKELLAVVFACEKFRSYLVGSPVVVFSD 712

Query: 114 CSLLPRALRCLGDSPKLQKWILSLQQFDMSFTKER 10
+ L L +L +WIL LQ+FD++ ++
Sbjct: 713 HAALKYLLSKKDSKARLVRWILLLQEFDITIKDKK 747


>tr|Q9SYC1|Q9SYC1_ARATH F11M15.5 protein OS=Arabidopsis thaliana
GN=F11M15.5 PE=4 SV=1
Length = 1295

Score = 54.3 bits (129), Expect = 3e-06
Identities = 29/84 (34%), Positives = 48/84 (57%)
Frame = -2

Query: 273 KQSYMRPVYYISKVKNDEQKSWHEIEQLVWALVYATKRLKSYLICKPFVVLTSCSLLPRA 94
++S RP++Y+SK +D + + +E+L A+V + ++L+ Y P VVLTS L
Sbjct: 809 ERSDERPIFYVSKSFSDAETRYPMMEKLALAVVTSARKLRPYFQSHPIVVLTSLP-LRAI 867

Query: 93 LRCLGDSPKLQKWILSLQQFDMSF 22
L S +L KW + L +FD+ F
Sbjct: 868 LHSPSQSGRLAKWAIELSEFDLEF 891


>tr|Q5W6Z3|Q5W6Z3_ORYSJ Putative polyprotein OS=Oryza sativa subsp.
japonica GN=OSJNBa0036C12.3 PE=4 SV=1
Length = 1565

Score = 53.9 bits (128), Expect = 4e-06
Identities = 25/86 (29%), Positives = 51/86 (59%)
Frame = -2

Query: 276 KKQSYMRPVYYISKVKNDEQKSWHEIEQLVWALVYATKRLKSYLICKPFVVLTSCSLLPR 97
+++ RPVYY+S+ +D + + +I++L++A++ +++L+ Y V++SC L
Sbjct: 1098 EREKVQRPVYYVSEALHDAKTRYPQIQKLLYAVIMTSRKLRHYFQAHRVTVVSSCP-LGE 1156

Query: 96 ALRCLGDSPKLQKWILSLQQFDMSFT 19
+R + KW++ L QFD+ FT
Sbjct: 1157 VVRNKDVVGCIVKWVVELSQFDVHFT 1182


>tr|A5BDE4|A5BDE4_VITVI Putative uncharacterized protein OS=Vitis
vinifera GN=VITISV_033762 PE=4 SV=1
Length = 414

Score = 53.9 bits (128), Expect = 4e-06
Identities = 30/95 (31%), Positives = 53/95 (55%)
Frame = -2

Query: 294 VLMQKGKKQSYMRPVYYISKVKNDEQKSWHEIEQLVWALVYATKRLKSYLICKPFVVLTS 115
VL Q+ ++ Y+ +YY SK N+ QK++ IE+ + A+V+ + ++YL+ +V T
Sbjct: 12 VLGQREDRKPYV--IYYASKTLNEAQKNYTTIEKELLAVVFTLDKFRAYLVGSFIIVFTD 69

Query: 114 CSLLPRALRCLGDSPKLQKWILSLQQFDMSFTKER 10
S L L +L +WIL LQ+FD+ ++
Sbjct: 70 HSALKYLLTKQDAKARLIRWILLLQEFDLQIRDKK 104


>tr|Q94885|Q94885_DROME Orf protein OS=Drosophila melanogaster GN=ORF
PE=1 SV=1
Length = 1494

Score = 53.9 bits (128), Expect = 4e-06
Identities = 29/88 (32%), Positives = 47/88 (53%)
Frame = -2

Query: 294 VLMQKGKKQSYMRPVYYISKVKNDEQKSWHEIEQLVWALVYATKRLKSYLICKPFVVLTS 115
VLMQK + Q + PV + SK D + +H E A+VY+ +R + YL + F ++T
Sbjct: 1027 VLMQKKEDQKW-HPVSFFSKRTTDIESKYHSFELETLAIVYSLRRFRVYLHWRTFKIVTD 1085

Query: 114 CSLLPRALRCLGDSPKLQKWILSLQQFD 31
C+ L L +P++ +W L Q +D
Sbjct: 1086 CNSLILTLSKKELNPRIARWALEFQGYD 1113


>tr|Q7X8Z6|Q7X8Z6_ORYSJ OSJNBa0093P23.6 protein (OSJNBa0041M21.11
protein) OS=Oryza sativa subsp. japonica
GN=OSJNBa0093P23.6 PE=4 SV=2
Length = 1770

Score = 53.5 bits (127), Expect = 5e-06
Identities = 24/89 (26%), Positives = 52/89 (58%)
Frame = -2

Query: 276 KKQSYMRPVYYISKVKNDEQKSWHEIEQLVWALVYATKRLKSYLICKPFVVLTSCSLLPR 97
+++ RPVYY+SK +D + + +I++L++A++ +++L+ Y V++S L
Sbjct: 1182 EREKIQRPVYYVSKALHDAKTRYSQIQKLLYAVIMTSRKLRHYFQAHRVTVVSSFP-LGE 1240

Query: 96 ALRCLGDSPKLQKWILSLQQFDMSFTKER 10
+R ++ KW++ L QFD+ F ++
Sbjct: 1241 VVRNKDVVSRIAKWVVELSQFDVHFVPQK 1269


>tr|Q01LU6|Q01LU6_ORYSA OSIGBa0136B09.5 protein OS=Oryza sativa
GN=OSIGBa0136B09.5 PE=4 SV=1
Length = 1770

Score = 53.5 bits (127), Expect = 5e-06
Identities = 24/89 (26%), Positives = 52/89 (58%)
Frame = -2

Query: 276 KKQSYMRPVYYISKVKNDEQKSWHEIEQLVWALVYATKRLKSYLICKPFVVLTSCSLLPR 97
+++ RPVYY+SK +D + + +I++L++A++ +++L+ Y V++S L
Sbjct: 1182 EREKIQRPVYYVSKALHDAKTRYSQIQKLLYAVIMTSRKLRHYFQAHRVTVVSSFP-LGE 1240

Query: 96 ALRCLGDSPKLQKWILSLQQFDMSFTKER 10
+R ++ KW++ L QFD+ F ++
Sbjct: 1241 VVRNKDVVSRIAKWVVELSQFDVHFVPQK 1269