BP917553
Clone id YMU001_000102_C10
Library
Length 385
Definition Adiantum capillus-veneris mRNA. clone: YMU001_000102_C10.
Accession
Tissue type prothallium
Developmental stage -
Contig ID -
Sequence
CCAACAAGCTCCCACTTAAAGACGACTATGCCTATAAGTGGGTCCTACTAGTCAGCTCCT
AGTATATACAAGATATAGGTGAGAGACTCTCTCAACCTATGCCCACCGGCTCACTCACTC
CATCTACATACAGTAGCATCGGCTCTAAGCAAGCATGAGAATCCATGCTAGAGCCTGTAT
GCAAATCCCGCAGACAATCCTGTAAGGTCTGCAATGCTCCACTAAGCATCATGCTAGCAT
CAGTCCTAACAGAACTGGCAATCCCTACTGCAAAAGAGCCAACTGCAATAGCCAAGTCGG
GCCTCGACAAAAGCAAGTCAAACATGAGACGCCCAACGCTGACGACATATGCACAATCGT
GGCTCTGTCAGCCTCCTCAGTATTA
■■Homology search results ■■ -
sp_hit_id Q9ET26
Definition sp|Q9ET26|RN114_MOUSE RING finger protein 114 OS=Mus musculus
Align length 78
Score (bit) 32.7
E-value 0.58
Report
BLASTX 2.2.19 [Nov-02-2008]


Reference: Altschul, Stephen F., Thomas L. Madden, Alejandro A. Schaffer,
Jinghui Zhang, Zheng Zhang, Webb Miller, and David J. Lipman (1997),
"Gapped BLAST and PSI-BLAST: a new generation of protein database search
programs", Nucleic Acids Res. 25:3389-3402.

Query= BP917553|Adiantum capillus-veneris mRNA, clone:
YMU001_000102_C10.
(385 letters)

Database: uniprot_sprot.fasta
412,525 sequences; 148,809,765 total letters

Searching..................................................done



Score E
Sequences producing significant alignments: (bits) Value

sp|Q9ET26|RN114_MOUSE RING finger protein 114 OS=Mus musculus GN... 33 0.58
sp|Q6J1I8|RN114_PIG RING finger protein 114 OS=Sus scrofa GN=RNF... 32 0.76
sp|Q5XGR0|MADL2_XENLA Myeloid-associated differentiation marker-... 32 1.00
sp|Q4U5R4|RN114_BOVIN RING finger protein 114 OS=Bos taurus GN=R... 31 2.2
sp|Q6J2U6|RN114_RAT RING finger protein 114 OS=Rattus norvegicus... 30 3.8
sp|Q91YD3|DCP1A_MOUSE mRNA-decapping enzyme 1A OS=Mus musculus G... 29 6.3
sp|Q9LH89|Y3885_ARATH Uncharacterized protein At3g28850 OS=Arabi... 29 6.5
sp|Q6J212|RN114_PANTR RING finger protein 114 OS=Pan troglodytes... 29 6.5
sp|Q9Y508|RN114_HUMAN RING finger protein 114 OS=Homo sapiens GN... 29 6.5
sp|A4X7V1|ACCDA_SALTO Acetyl-coenzyme A carboxylase carboxyl tra... 29 6.5
sp|O35049|NSMA2_RAT Sphingomyelin phosphodiesterase 3 OS=Rattus ... 29 8.2
sp|Q9JJY3|NSMA2_MOUSE Sphingomyelin phosphodiesterase 3 OS=Mus m... 29 8.2
sp|A3PWC1|AROA_MYCSJ 3-phosphoshikimate 1-carboxyvinyltransferas... 29 8.4

>sp|Q9ET26|RN114_MOUSE RING finger protein 114 OS=Mus musculus
GN=Rnf114 PE=2 SV=2
Length = 229

Score = 32.7 bits (73), Expect = 0.58
Identities = 20/78 (25%), Positives = 34/78 (43%), Gaps = 6/78 (7%)
Frame = +2

Query: 149 ASMRIHARACMQIPQTIL*GLQCSTKHHASISPNRTGN------PYCKRANCNSQVGPRQ 310
+ +R H +C + I+ G++ +TK AS+ P N PYC N + +
Sbjct: 102 SKIRAHVTSCSKYQNYIMEGVKATTKD-ASLQPRNIPNRYTFPCPYCPEKNFDQEGLVEH 160

Query: 311 KQVKHETPNADDICTIVA 364
++ H T +C I A
Sbjct: 161 CKLTHSTDTKSVVCPICA 178


>sp|Q6J1I8|RN114_PIG RING finger protein 114 OS=Sus scrofa GN=RNF114
PE=2 SV=1
Length = 228

Score = 32.3 bits (72), Expect = 0.76
Identities = 20/78 (25%), Positives = 33/78 (42%), Gaps = 6/78 (7%)
Frame = +2

Query: 149 ASMRIHARACMQIPQTIL*GLQCSTKHHASISPNRTGN------PYCKRANCNSQVGPRQ 310
+ +R H C + I+ G++ +TK AS+ P N PYC N + +
Sbjct: 101 SKIRAHVATCSKYQNYIMEGVKATTKD-ASLQPRNVPNRYTFPCPYCPEKNFDQEGLVEH 159

Query: 311 KQVKHETPNADDICTIVA 364
++ H T +C I A
Sbjct: 160 CKLVHSTDTKSVVCPICA 177


>sp|Q5XGR0|MADL2_XENLA Myeloid-associated differentiation
marker-like protein 2 OS=Xenopus laevis GN=myadml2 PE=2
SV=1
Length = 302

Score = 32.0 bits (71), Expect = 1.00
Identities = 20/77 (25%), Positives = 36/77 (46%)
Frame = -1

Query: 334 GRLMFDLLLSRPDLAIAVGSFAVGIASSVRTDASMMLSGALQTLQDCLRDLHTGSSMDSH 155
G F L+L R + A G+F V + + ++++ L LQ CLR + G+ ++
Sbjct: 29 GCTTFSLVLHRAGFSAAYGTFCVFVWAFCFALTILIVTCELTRLQSCLRSISWGNFTAAY 88

Query: 154 ACLEPMLLYVDGVSEPV 104
A L ++ V P+
Sbjct: 89 AMLATLMTLTAAVIYPM 105


>sp|Q4U5R4|RN114_BOVIN RING finger protein 114 OS=Bos taurus
GN=RNF114 PE=2 SV=1
Length = 230

Score = 30.8 bits (68), Expect = 2.2
Identities = 20/78 (25%), Positives = 32/78 (41%), Gaps = 6/78 (7%)
Frame = +2

Query: 149 ASMRIHARACMQIPQTIL*GLQCSTKHHASISPNRTGN------PYCKRANCNSQVGPRQ 310
+ +R H C + I+ G++ +TK AS P N PYC N + +
Sbjct: 103 SKIRAHVATCSKYQNYIMEGVKATTKD-ASRQPRSVPNRYTFPCPYCPEKNFDQEGLVEH 161

Query: 311 KQVKHETPNADDICTIVA 364
++ H T +C I A
Sbjct: 162 CKLSHSTDTKSVVCPICA 179


>sp|Q6J2U6|RN114_RAT RING finger protein 114 OS=Rattus norvegicus
GN=Rnf114 PE=2 SV=1
Length = 229

Score = 30.0 bits (66), Expect = 3.8
Identities = 19/78 (24%), Positives = 33/78 (42%), Gaps = 6/78 (7%)
Frame = +2

Query: 149 ASMRIHARACMQIPQTIL*GLQCSTKHHASISPNRTGN------PYCKRANCNSQVGPRQ 310
+ +R H +C + I+ G++ +TK AS+ N PYC N + +
Sbjct: 102 SKIRAHVASCSKYQSYIMEGVKATTKD-ASLQQRNVPNRYTFPCPYCPEKNFDQEGLVEH 160

Query: 311 KQVKHETPNADDICTIVA 364
++ H T +C I A
Sbjct: 161 CKLTHSTDTKSVVCPICA 178


>sp|Q91YD3|DCP1A_MOUSE mRNA-decapping enzyme 1A OS=Mus musculus
GN=Dcp1a PE=1 SV=1
Length = 602

Score = 29.3 bits (64), Expect = 6.3
Identities = 16/56 (28%), Positives = 28/56 (50%)
Frame = +3

Query: 90 SQPMPTGSLTPSTYSSIGSKQA*ESMLEPVCKSRRQSCKVCNAPLSIMLASVLTEL 257
+QP+ G++ PS S+ G ES +EP K+ V + +++LA L +
Sbjct: 428 AQPLGKGTMAPSFSSAAGQLATPESFIEPSSKTAAARAAVSASLSNMVLAPTLQSM 483


>sp|Q9LH89|Y3885_ARATH Uncharacterized protein At3g28850
OS=Arabidopsis thaliana GN=At3g28850 PE=1 SV=1
Length = 428

Score = 29.3 bits (64), Expect = 6.5
Identities = 14/39 (35%), Positives = 22/39 (56%)
Frame = +2

Query: 266 YCKRANCNSQVGPRQKQVKHETPNADDICTIVALSASSV 382
+C+R R V H + N++D C +VALS+SS+
Sbjct: 14 HCRRGYSPPVDVQRSHSVHHASQNSEDSCHMVALSSSSL 52


>sp|Q6J212|RN114_PANTR RING finger protein 114 OS=Pan troglodytes
GN=RNF114 PE=2 SV=1
Length = 228

Score = 29.3 bits (64), Expect = 6.5
Identities = 19/78 (24%), Positives = 32/78 (41%), Gaps = 6/78 (7%)
Frame = +2

Query: 149 ASMRIHARACMQIPQTIL*GLQCSTKHHASISPNRTGN------PYCKRANCNSQVGPRQ 310
+ +R H C + I+ G++ + K AS+ P N PYC N + +
Sbjct: 101 SKIRSHVATCSKYQNYIMEGVKATIKD-ASLQPRNVPNRYTFPCPYCPEKNFDQEGLVEH 159

Query: 311 KQVKHETPNADDICTIVA 364
++ H T +C I A
Sbjct: 160 CKLFHSTDTKSVVCPICA 177


>sp|Q9Y508|RN114_HUMAN RING finger protein 114 OS=Homo sapiens
GN=RNF114 PE=1 SV=1
Length = 228

Score = 29.3 bits (64), Expect = 6.5
Identities = 19/78 (24%), Positives = 32/78 (41%), Gaps = 6/78 (7%)
Frame = +2

Query: 149 ASMRIHARACMQIPQTIL*GLQCSTKHHASISPNRTGN------PYCKRANCNSQVGPRQ 310
+ +R H C + I+ G++ + K AS+ P N PYC N + +
Sbjct: 101 SKIRSHVATCSKYQNYIMEGVKATIKD-ASLQPRNVPNRYTFPCPYCPEKNFDQEGLVEH 159

Query: 311 KQVKHETPNADDICTIVA 364
++ H T +C I A
Sbjct: 160 CKLFHSTDTKSVVCPICA 177


>sp|A4X7V1|ACCDA_SALTO Acetyl-coenzyme A carboxylase carboxyl
transferase subunits beta/alpha OS=Salinispora tropica
(strain ATCC BAA-916 / DSM 44818 / CNB-440) GN=accD PE=3
SV=1
Length = 566

Score = 29.3 bits (64), Expect = 6.5
Identities = 25/79 (31%), Positives = 31/79 (39%), Gaps = 5/79 (6%)
Frame = -1

Query: 298 DLAIAVGSFAVGIASS--VRTDASMMLSGALQTLQDCLRDLHTGSSMDSHA---CLEPML 134
D+ IA +G A +R L QT + LR + HA CL +L
Sbjct: 203 DVVIAESGARMGFAGPRVIRQVTGRELPDGFQTAEFLLRHGQVDLVVPRHALRGCLATLL 262

Query: 133 LYVDGVSEPVGIG*ESLSP 77
G EPVG G ES P
Sbjct: 263 AAASGGREPVGAGHESECP 281


tr_hit_id A7QYX1
Definition tr|A7QYX1|A7QYX1_VITVI Chromosome chr16 scaffold_258, whole genome shotgun sequence OS=Vitis vinifera
Align length 117
Score (bit) 33.9
E-value 4.2
Report
BLASTX 2.2.19 [Nov-02-2008]


Reference: Altschul, Stephen F., Thomas L. Madden, Alejandro A. Schaffer,
Jinghui Zhang, Zheng Zhang, Webb Miller, and David J. Lipman (1997),
"Gapped BLAST and PSI-BLAST: a new generation of protein database search
programs", Nucleic Acids Res. 25:3389-3402.

Query= BP917553|Adiantum capillus-veneris mRNA, clone:
YMU001_000102_C10.
(385 letters)

Database: uniprot_trembl.fasta
7,341,751 sequences; 2,391,615,440 total letters

Searching..................................................done



Score E
Sequences producing significant alignments: (bits) Value

tr|A7QYX1|A7QYX1_VITVI Chromosome chr16 scaffold_258, whole geno... 34 4.2
tr|Q2RX39|Q2RX39_RHORT Putative uncharacterized protein OS=Rhodo... 33 7.2
tr|Q3UC35|Q3UC35_MOUSE Putative uncharacterized protein (Fragmen... 33 9.3
tr|A2A462|A2A462_MOUSE Ring finger protein 114 OS=Mus musculus G... 33 9.3
tr|Q8P3N6|Q8P3N6_XANCP Putative uncharacterized protein XCC4035 ... 33 9.3
tr|Q4UP60|Q4UP60_XANC8 Putative uncharacterized protein OS=Xanth... 33 9.3
tr|B0RYR4|B0RYR4_XANCB Putative transport protein OS=Xanthomonas... 33 9.3
tr|B0X5X2|B0X5X2_CULQU Transcriptional regulator ATRX OS=Culex q... 33 9.3

>tr|A7QYX1|A7QYX1_VITVI Chromosome chr16 scaffold_258, whole genome
shotgun sequence OS=Vitis vinifera GN=GSVIVT00010380001
PE=4 SV=1
Length = 260

Score = 33.9 bits (76), Expect = 4.2
Identities = 31/117 (26%), Positives = 51/117 (43%), Gaps = 12/117 (10%)
Frame = +3

Query: 69 QDIGERLSQPMPTGSLTPSTYSSIGSKQA*ESM---LEPVCKSRRQSCKVCNAPLSIMLA 239
+D+G SQP G + + + K +M LE + + Q CK+C P +++
Sbjct: 45 RDMGRMKSQPNAKGGMYVLS-EDMDMKAKFATMARRLEELELKKVQECKLCLVPYVSLMS 103

Query: 240 SVLTEL-AIPTAKEPTAIAKSGLDKSKSNMRRPTLTTYAQS--------WLCQPPQY 383
+ L E IP +E + +D+ K N P +TY + W +PPQY
Sbjct: 104 TWLEECPTIPAVREMFGDQANVVDQLKPNNYAPYGSTYNSNWRNHPNFSWKPRPPQY 160


>tr|Q2RX39|Q2RX39_RHORT Putative uncharacterized protein
OS=Rhodospirillum rubrum (strain ATCC 11170 / NCIB 8255)
GN=Rru_A0502 PE=4 SV=1
Length = 1325

Score = 33.1 bits (74), Expect = 7.2
Identities = 19/47 (40%), Positives = 25/47 (53%)
Frame = -1

Query: 310 LSRPDLAIAVGSFAVGIASSVRTDASMMLSGALQTLQDCLRDLHTGS 170
L PDLA+ VG+ GIA++ R D LS A+ TL H G+
Sbjct: 255 LGLPDLALQVGTLMPGIAAATRFDDKTTLSQAVSTLTGLRPLAHFGT 301


>tr|Q3UC35|Q3UC35_MOUSE Putative uncharacterized protein (Fragment)
OS=Mus musculus GN=Rnf114 PE=2 SV=1
Length = 146

Score = 32.7 bits (73), Expect = 9.3
Identities = 20/78 (25%), Positives = 34/78 (43%), Gaps = 6/78 (7%)
Frame = +2

Query: 149 ASMRIHARACMQIPQTIL*GLQCSTKHHASISPNRTGN------PYCKRANCNSQVGPRQ 310
+ +R H +C + I+ G++ +TK AS+ P N PYC N + +
Sbjct: 19 SKIRAHVTSCSKYQNYIMEGVKATTKD-ASLQPRNIPNRYTFPCPYCPEKNFDQEGLVEH 77

Query: 311 KQVKHETPNADDICTIVA 364
++ H T +C I A
Sbjct: 78 CKLTHSTDTKSVVCPICA 95


>tr|A2A462|A2A462_MOUSE Ring finger protein 114 OS=Mus musculus
GN=Rnf114 PE=4 SV=1
Length = 229

Score = 32.7 bits (73), Expect = 9.3
Identities = 20/78 (25%), Positives = 34/78 (43%), Gaps = 6/78 (7%)
Frame = +2

Query: 149 ASMRIHARACMQIPQTIL*GLQCSTKHHASISPNRTGN------PYCKRANCNSQVGPRQ 310
+ +R H +C + I+ G++ +TK AS+ P N PYC N + +
Sbjct: 102 SKIRAHVTSCSKYQNYIMEGVKATTKD-ASLQPRNIPNRYTFPCPYCPEKNFDQEGLVEH 160

Query: 311 KQVKHETPNADDICTIVA 364
++ H T +C I A
Sbjct: 161 CKLTHSTDTKSVVCPICA 178


>tr|Q8P3N6|Q8P3N6_XANCP Putative uncharacterized protein XCC4035
OS=Xanthomonas campestris pv. campestris GN=XCC4035 PE=4
SV=1
Length = 207

Score = 32.7 bits (73), Expect = 9.3
Identities = 16/35 (45%), Positives = 24/35 (68%)
Frame = -1

Query: 295 LAIAVGSFAVGIASSVRTDASMMLSGALQTLQDCL 191
LAI GSFA+ +A ++ + A+ +LSG+L L D L
Sbjct: 29 LAINAGSFALMLAGALHSGAASLLSGSLDNLGDAL 63


>tr|Q4UP60|Q4UP60_XANC8 Putative uncharacterized protein
OS=Xanthomonas campestris pv. campestris (strain 8004)
GN=XC_4124 PE=4 SV=1
Length = 207

Score = 32.7 bits (73), Expect = 9.3
Identities = 16/35 (45%), Positives = 24/35 (68%)
Frame = -1

Query: 295 LAIAVGSFAVGIASSVRTDASMMLSGALQTLQDCL 191
LAI GSFA+ +A ++ + A+ +LSG+L L D L
Sbjct: 29 LAINAGSFALMLAGALHSGAASLLSGSLDNLGDAL 63


>tr|B0RYR4|B0RYR4_XANCB Putative transport protein OS=Xanthomonas
campestris pv. campestris (strain B100) GN=xcc-b100_4231
PE=4 SV=1
Length = 207

Score = 32.7 bits (73), Expect = 9.3
Identities = 16/35 (45%), Positives = 24/35 (68%)
Frame = -1

Query: 295 LAIAVGSFAVGIASSVRTDASMMLSGALQTLQDCL 191
LAI GSFA+ +A ++ + A+ +LSG+L L D L
Sbjct: 29 LAINAGSFALMLAGALHSGAASLLSGSLDNLGDAL 63


>tr|B0X5X2|B0X5X2_CULQU Transcriptional regulator ATRX OS=Culex
quinquefasciatus GN=CpipJ_CPIJ014692 PE=4 SV=1
Length = 1676

Score = 32.7 bits (73), Expect = 9.3
Identities = 18/57 (31%), Positives = 29/57 (50%)
Frame = +2

Query: 209 LQCSTKHHASISPNRTGNPYCKRANCNSQVGPRQKQVKHETPNADDICTIVALSASS 379
L C+T AS S T + + + VGPR +Q +HE ++D IV +A++
Sbjct: 12 LTCATSQTASASVRSTPSSTKLAPSSSDTVGPRLEQKRHEGDSSDGAAIIVTATAAA 68