BP917578
Clone id YMU001_000102_F04
Library
Length 534
Definition Adiantum capillus-veneris mRNA. clone: YMU001_000102_F04.
Accession
Tissue type prothallium
Developmental stage -
Contig ID
Sequence
TATGATTTTCCTCCAGACGTGAGGATAAAGATTCACAGATATGGGGCAAAGAATGGACTG
GGCAAGCACAAAAGTGGTTTCTGTTCAGGTTTAAAGGAGATGAAAAAGAGATAAATCTGA
ATGTGAATGGGATCGAAAGAGCGGAGTTCTCAGATTGGAAGTGGGCTTCAGCTAATGAAG
TTCTTGGAAGGGCGGTCGATTTCAAAAAACCGGTGTACGAAAAAGTTTTGGAGGCTTTTG
CACCAACCTTGAAATGGGATAGTGGGGGAATTTCTATTGAAACAGAAATGCTTTGATTAA
TTGATTGTAGTGGTATGTGAGCTGTCATGCTTGCTGGTGTCACCGACAAGCGCAGATAGC
TTGAGGCACCTGCCTTGGAGTCAGGTGAAAATTTCACCTCTTAGTTCTCTGTATGTCACT
GAGCCCAATGATGTGACTTCCACGACTATTCTTTACTCAAGCAAAAGTTGTCTTGAAAGG
GGGGACTCAAACCCACGTCTTCGCTGTTATGAAGGGACAACCACGTTTTCCTGC
■■Homology search results ■■ -
sp_hit_id Q3IZC1
Definition sp|Q3IZC1|RPPH_RHOS4 RNA pyrophosphohydrolase OS=Rhodobacter sphaeroides (strain ATCC 17023 / 2.4.1 / NCIB 8253 / DSM 158)
Align length 72
Score (bit) 73.9
E-value 4.0e-13
Report
BLASTX 2.2.19 [Nov-02-2008]


Reference: Altschul, Stephen F., Thomas L. Madden, Alejandro A. Schaffer,
Jinghui Zhang, Zheng Zhang, Webb Miller, and David J. Lipman (1997),
"Gapped BLAST and PSI-BLAST: a new generation of protein database search
programs", Nucleic Acids Res. 25:3389-3402.

Query= BP917578|Adiantum capillus-veneris mRNA, clone:
YMU001_000102_F04.
(534 letters)

Database: uniprot_sprot.fasta
412,525 sequences; 148,809,765 total letters

Searching..................................................done



Score E
Sequences producing significant alignments: (bits) Value

sp|Q3IZC1|RPPH_RHOS4 RNA pyrophosphohydrolase OS=Rhodobacter sph... 74 4e-13
sp|A4WWV6|RPPH_RHOS5 RNA pyrophosphohydrolase OS=Rhodobacter sph... 73 8e-13
sp|A3PMX6|RPPH_RHOS1 RNA pyrophosphohydrolase OS=Rhodobacter sph... 73 8e-13
sp|Q5GT39|RPPH_WOLTR RNA pyrophosphohydrolase OS=Wolbachia sp. s... 70 8e-12
sp|Q5LMH8|RPPH_SILPO RNA pyrophosphohydrolase OS=Silicibacter po... 69 1e-11
sp|P61787|RPPH_WOLPM RNA pyrophosphohydrolase OS=Wolbachia pipie... 68 2e-11
sp|A8EXY5|RPPH_RICCK RNA pyrophosphohydrolase OS=Rickettsia cana... 67 5e-11
sp|Q89X78|RPPH_BRAJA RNA pyrophosphohydrolase OS=Bradyrhizobium ... 66 1e-10
sp|Q2RV14|RPPH_RHORT RNA pyrophosphohydrolase OS=Rhodospirillum ... 65 2e-10
sp|A5CD16|RPPH_ORITB RNA pyrophosphohydrolase OS=Orientia tsutsu... 65 2e-10
sp|A8GRA7|RPPH_RICRS RNA pyrophosphohydrolase OS=Rickettsia rick... 65 2e-10
sp|B0BWQ7|RPPH_RICRO RNA pyrophosphohydrolase OS=Rickettsia rick... 65 2e-10
sp|Q4UKM5|RPPH_RICFE RNA pyrophosphohydrolase OS=Rickettsia feli... 65 2e-10
sp|Q92IV0|RPPH_RICCN RNA pyrophosphohydrolase OS=Rickettsia cono... 65 2e-10
sp|A8GMN4|RPPH_RICAH RNA pyrophosphohydrolase OS=Rickettsia akar... 65 2e-10
sp|Q12KG5|RPPH_SHEDO RNA pyrophosphohydrolase OS=Shewanella deni... 64 5e-10
sp|Q16BL5|RPPH_ROSDO RNA pyrophosphohydrolase OS=Roseobacter den... 64 5e-10
sp|A8LKJ8|RPPH_DINSH RNA pyrophosphohydrolase OS=Dinoroseobacter... 64 5e-10
sp|Q68XD3|RPPH_RICTY RNA pyrophosphohydrolase OS=Rickettsia typh... 63 8e-10
sp|Q9ZDT9|RPPH_RICPR RNA pyrophosphohydrolase OS=Rickettsia prow... 63 8e-10
sp|Q1RHV9|RPPH_RICBR RNA pyrophosphohydrolase OS=Rickettsia bell... 63 8e-10
sp|A8GW83|RPPH_RICB8 RNA pyrophosphohydrolase OS=Rickettsia bell... 63 8e-10
sp|Q21CZ3|RPPH_RHOPB RNA pyrophosphohydrolase OS=Rhodopseudomona... 63 8e-10
sp|Q2G7H8|RPPH_NOVAD RNA pyrophosphohydrolase OS=Novosphingobium... 63 8e-10
sp|Q3SVH3|RPPH_NITWN RNA pyrophosphohydrolase OS=Nitrobacter win... 63 8e-10
sp|A8FSC0|RPPH_SHESH RNA pyrophosphohydrolase OS=Shewanella sedi... 63 1e-09
sp|Q07YY0|RPPH_SHEFN RNA pyrophosphohydrolase OS=Shewanella frig... 63 1e-09
sp|Q9RH11|RPPH_ZYMMO RNA pyrophosphohydrolase OS=Zymomonas mobil... 62 1e-09
sp|Q13DN7|RPPH_RHOPS RNA pyrophosphohydrolase OS=Rhodopseudomona... 62 1e-09
sp|P61786|RPPH_RHOPA RNA pyrophosphohydrolase OS=Rhodopseudomona... 62 2e-09

>sp|Q3IZC1|RPPH_RHOS4 RNA pyrophosphohydrolase OS=Rhodobacter
sphaeroides (strain ATCC 17023 / 2.4.1 / NCIB 8253 / DSM
158) GN=rppH PE=3 SV=1
Length = 162

Score = 73.9 bits (180), Expect = 4e-13
Identities = 31/72 (43%), Positives = 48/72 (66%)
Frame = +3

Query: 36 QIWGKEWTGQAQKWFLFRFKGDEKEINLNVNGIERAEFSDWKWASANEVLGRAVDFKKPV 215
++WG ++ GQ QKWFL+R+ G ++E+ + G + AEFS W+W A E++ V FK+ V
Sbjct: 93 RVWGGKYRGQRQKWFLYRYLGTDEEVGI---GTDHAEFSCWRWIGAEEMVAAIVPFKRAV 149

Query: 216 YEKVLEAFAPTL 251
YE+V+ F P L
Sbjct: 150 YEEVVATFRPHL 161


>sp|A4WWV6|RPPH_RHOS5 RNA pyrophosphohydrolase OS=Rhodobacter
sphaeroides (strain ATCC 17025 / ATH 2.4.3) GN=rppH PE=3
SV=1
Length = 162

Score = 73.2 bits (178), Expect = 8e-13
Identities = 31/68 (45%), Positives = 46/68 (67%)
Frame = +3

Query: 36 QIWGKEWTGQAQKWFLFRFKGDEKEINLNVNGIERAEFSDWKWASANEVLGRAVDFKKPV 215
++WG ++ GQ QKWFLFR+ G +++I + E AEFS W+W A E++ V FK+PV
Sbjct: 93 RVWGGKYRGQRQKWFLFRYLGTDEQIGI---ATEHAEFSCWRWIGAEEMVASIVPFKRPV 149

Query: 216 YEKVLEAF 239
YE+V+ F
Sbjct: 150 YERVVAMF 157


>sp|A3PMX6|RPPH_RHOS1 RNA pyrophosphohydrolase OS=Rhodobacter
sphaeroides (strain ATCC 17029 / ATH 2.4.9) GN=rppH PE=3
SV=1
Length = 162

Score = 73.2 bits (178), Expect = 8e-13
Identities = 31/72 (43%), Positives = 47/72 (65%)
Frame = +3

Query: 36 QIWGKEWTGQAQKWFLFRFKGDEKEINLNVNGIERAEFSDWKWASANEVLGRAVDFKKPV 215
++WG ++ GQ QKWFL+R+ G + E+ + G + AEFS W+W A E++ V FK+ V
Sbjct: 93 RVWGGKYRGQRQKWFLYRYLGTDDEVGI---GTDHAEFSCWRWIGAEEMVAAIVPFKRAV 149

Query: 216 YEKVLEAFAPTL 251
YE+V+ F P L
Sbjct: 150 YEEVVATFRPHL 161


>sp|Q5GT39|RPPH_WOLTR RNA pyrophosphohydrolase OS=Wolbachia sp.
subsp. Brugia malayi (strain TRS) GN=rppH PE=3 SV=1
Length = 161

Score = 69.7 bits (169), Expect = 8e-12
Identities = 28/71 (39%), Positives = 46/71 (64%)
Frame = +3

Query: 42 WGKEWTGQAQKWFLFRFKGDEKEINLNVNGIERAEFSDWKWASANEVLGRAVDFKKPVYE 221
W ++GQ Q+WFL +F G+ K+IN+N + EF +W+W S + ++ A+ FKK VY+
Sbjct: 88 WNGRYSGQKQRWFLMKFYGEGKDININYT--DHPEFKEWRWQSVDNLVAGAIPFKKEVYK 145

Query: 222 KVLEAFAPTLK 254
V+E F+ +K
Sbjct: 146 TVIEEFSSQIK 156


>sp|Q5LMH8|RPPH_SILPO RNA pyrophosphohydrolase OS=Silicibacter
pomeroyi GN=rppH PE=3 SV=1
Length = 161

Score = 68.9 bits (167), Expect = 1e-11
Identities = 32/72 (44%), Positives = 44/72 (61%)
Frame = +3

Query: 36 QIWGKEWTGQAQKWFLFRFKGDEKEINLNVNGIERAEFSDWKWASANEVLGRAVDFKKPV 215
+IW + GQ QKW+LFRF G + +I+L EFS WKW + ++ V FK+ V
Sbjct: 92 RIWKGRYRGQEQKWYLFRFLGRDDQIDLETG---HPEFSRWKWQDPDRLVAEIVPFKRDV 148

Query: 216 YEKVLEAFAPTL 251
YE+V+ AFAP L
Sbjct: 149 YERVVAAFAPHL 160


>sp|P61787|RPPH_WOLPM RNA pyrophosphohydrolase OS=Wolbachia
pipientis wMel GN=rppH PE=3 SV=1
Length = 162

Score = 68.2 bits (165), Expect = 2e-11
Identities = 26/71 (36%), Positives = 47/71 (66%)
Frame = +3

Query: 42 WGKEWTGQAQKWFLFRFKGDEKEINLNVNGIERAEFSDWKWASANEVLGRAVDFKKPVYE 221
W +++GQ Q+WFL +F G++++I++N G EF +W+W + ++ A+ FKK VY+
Sbjct: 88 WNGKYSGQKQRWFLMKFCGEDEDIDINYTG--HPEFKEWRWQGIDSLVASAISFKKEVYK 145

Query: 222 KVLEAFAPTLK 254
V+E F+ +K
Sbjct: 146 TVIEEFSSIIK 156


>sp|A8EXY5|RPPH_RICCK RNA pyrophosphohydrolase OS=Rickettsia
canadensis (strain McKiel) GN=rppH PE=3 SV=1
Length = 161

Score = 67.0 bits (162), Expect = 5e-11
Identities = 27/68 (39%), Positives = 44/68 (64%)
Frame = +3

Query: 36 QIWGKEWTGQAQKWFLFRFKGDEKEINLNVNGIERAEFSDWKWASANEVLGRAVDFKKPV 215
++W + GQ Q+WFL RF G+ ++IN+N + EF W+WAS NE+L + FK+ +
Sbjct: 92 KLWNGNFRGQKQRWFLIRFTGNNEDININTS---NPEFDQWRWASLNELLSIIIPFKRKL 148

Query: 216 YEKVLEAF 239
Y+ V++ F
Sbjct: 149 YQAVVKEF 156


>sp|Q89X78|RPPH_BRAJA RNA pyrophosphohydrolase OS=Bradyrhizobium
japonicum GN=rppH PE=3 SV=1
Length = 167

Score = 65.9 bits (159), Expect = 1e-10
Identities = 29/68 (42%), Positives = 41/68 (60%), Gaps = 1/68 (1%)
Frame = +3

Query: 42 WGKEWTGQAQKWFLFRFKGDEKEINL-NVNGIERAEFSDWKWASANEVLGRAVDFKKPVY 218
W + GQ QKWF RF G + EIN+ N G +AEF W+W + G + FK+PVY
Sbjct: 95 WKGRYRGQRQKWFAVRFTGKDSEINVENPGGGHKAEFVSWRWEPMKNLPGLIIPFKRPVY 154

Query: 219 EKVLEAFA 242
E+V++ F+
Sbjct: 155 ERVVKEFS 162


>sp|Q2RV14|RPPH_RHORT RNA pyrophosphohydrolase OS=Rhodospirillum
rubrum (strain ATCC 11170 / NCIB 8255) GN=rppH PE=3 SV=1
Length = 165

Score = 65.5 bits (158), Expect = 2e-10
Identities = 29/74 (39%), Positives = 42/74 (56%)
Frame = +3

Query: 21 EDKDSQIWGKEWTGQAQKWFLFRFKGDEKEINLNVNGIERAEFSDWKWASANEVLGRAVD 200
E+ ++WG + GQ QKWF FRF G + +INL EF W+W + ++ V
Sbjct: 87 EELRGRLWGGRFQGQRQKWFAFRFTGQDADINL---ATAHPEFDAWRWVDVDTLVALIVP 143

Query: 201 FKKPVYEKVLEAFA 242
FK+PVYE+V+ A
Sbjct: 144 FKRPVYEQVVAELA 157


>sp|A5CD16|RPPH_ORITB RNA pyrophosphohydrolase OS=Orientia
tsutsugamushi (strain Boryong) GN=rppH PE=3 SV=1
Length = 161

Score = 65.5 bits (158), Expect = 2e-10
Identities = 26/68 (38%), Positives = 44/68 (64%)
Frame = +3

Query: 36 QIWGKEWTGQAQKWFLFRFKGDEKEINLNVNGIERAEFSDWKWASANEVLGRAVDFKKPV 215
++W + GQ QKWFL +F G +++IN+N EFS WKW ++N+++ A+ FK+ +
Sbjct: 92 KLWNSNFKGQKQKWFLIKFLGKDEDININT---IYPEFSQWKWMNSNQLINNALPFKRKL 148

Query: 216 YEKVLEAF 239
Y+ V+ F
Sbjct: 149 YKAVINEF 156


tr_hit_id B4FH69
Definition tr|B4FH69|B4FH69_MAIZE Putative uncharacterized protein OS=Zea mays
Align length 78
Score (bit) 100.0
E-value 7.0e-22
Report
BLASTX 2.2.19 [Nov-02-2008]


Reference: Altschul, Stephen F., Thomas L. Madden, Alejandro A. Schaffer,
Jinghui Zhang, Zheng Zhang, Webb Miller, and David J. Lipman (1997),
"Gapped BLAST and PSI-BLAST: a new generation of protein database search
programs", Nucleic Acids Res. 25:3389-3402.

Query= BP917578|Adiantum capillus-veneris mRNA, clone:
YMU001_000102_F04.
(534 letters)

Database: uniprot_trembl.fasta
7,341,751 sequences; 2,391,615,440 total letters

Searching..................................................done



Score E
Sequences producing significant alignments: (bits) Value

tr|B4FH69|B4FH69_MAIZE Putative uncharacterized protein OS=Zea m... 100 7e-22
tr|B6TIH5|B6TIH5_MAIZE Putative uncharacterized protein OS=Zea m... 100 5e-21
tr|A9NP51|A9NP51_PICSI Putative uncharacterized protein OS=Picea... 103 6e-21
tr|B6U9P7|B6U9P7_MAIZE Putative uncharacterized protein OS=Zea m... 100 6e-21
tr|O24005|O24005_HORVU Diadenosine 5',5'''-P1,P4-tetraphosphate ... 99 1e-19
tr|Q9CAF2|Q9CAF2_ARATH Putative diadenosine 5',5'''-P1,P4-tetrap... 92 6e-19
tr|Q9LPN7|Q9LPN7_ARATH Diadenosine 5',5'''-P1,P4-tetraphosphate ... 92 6e-19
tr|Q7XPT6|Q7XPT6_ORYSJ OSJNBa0088H09.20 protein (OSJNBa0070M12.2... 96 1e-18
tr|Q259N5|Q259N5_ORYSA H0723C07.5 protein OS=Oryza sativa GN=H07... 96 1e-18
tr|Q0J8V1|Q0J8V1_ORYSJ Os04g0685800 protein (Fragment) OS=Oryza ... 96 1e-18
tr|B8ART5|B8ART5_ORYSI Putative uncharacterized protein OS=Oryza... 96 1e-18
tr|A3AYU1|A3AYU1_ORYSJ Putative uncharacterized protein OS=Oryza... 96 1e-18
tr|A7Q9S4|A7Q9S4_VITVI Chromosome chr8 scaffold_68, whole genome... 93 1e-17
tr|A9RPX0|A9RPX0_PHYPA Predicted protein (Fragment) OS=Physcomit... 89 1e-17
tr|O04841|O04841_LUPAN Diadenosine 5',5'''-P1,P4-tetraphosphate ... 92 1e-17
tr|A5BKT0|A5BKT0_VITVI Putative uncharacterized protein (Chromos... 85 2e-16
tr|Q9C6Z2|Q9C6Z2_ARATH Diadenosine 5,5-P1,P4-tetraphosphate hydr... 84 3e-16
tr|Q0WMS9|Q0WMS9_ARATH Putative uncharacterized protein At1g3011... 84 3e-16
tr|A5C8J1|A5C8J1_VITVI Putative uncharacterized protein OS=Vitis... 87 7e-16
tr|A1YMY8|A1YMY8_BRACM Bis(5'-nucleosy1)-tetraphosphatase OS=Bra... 79 3e-14
tr|Q9FNH4|Q9FNH4_ARATH Diadenosine 5',5'''-P1,P4-tetraphosphate ... 80 9e-14
tr|Q0FVJ9|Q0FVJ9_9RHOB Hydrolase, NUDIX family, NudH subfamily p... 76 9e-13
tr|A3KAC6|A3KAC6_9RHOB Hydrolase, NUDIX family, NudH subfamily p... 74 6e-12
tr|B7RNA3|B7RNA3_9RHOB (Di)nucleoside polyphosphate hydrolase OS... 73 1e-11
tr|B3CM46|B3CM46_WOLPP (Di)nucleoside polyphosphate hydrolase OS... 72 2e-11
tr|B6Y6F7|B6Y6F7_9RICK (Di)nucleoside polyphosphate hydrolase OS... 72 2e-11
tr|B6B2Q9|B6B2Q9_9RHOB (Di)nucleoside polyphosphate hydrolase OS... 70 5e-11
tr|Q1YKA5|Q1YKA5_MOBAS (Di)nucleoside polyphosphate hydrolase, i... 70 9e-11
tr|A4TXH6|A4TXH6_9PROT Invasion protein A OS=Magnetospirillum gr... 69 2e-10
tr|A3SV50|A3SV50_9RHOB Hydrolase, NUDIX family, NudH subfamily p... 69 2e-10

>tr|B4FH69|B4FH69_MAIZE Putative uncharacterized protein OS=Zea mays
PE=2 SV=1
Length = 169

Score = 100 bits (250), Expect(2) = 7e-22
Identities = 44/78 (56%), Positives = 56/78 (71%)
Frame = +3

Query: 42 WGKEWTGQAQKWFLFRFKGDEKEINLNVNGIERAEFSDWKWASANEVLGRAVDFKKPVYE 221
WG +W GQAQKWFLFR G++ EINLN +G E+ EF +W W + EV+ +AVDFKKPVYE
Sbjct: 92 WGTDWKGQAQKWFLFRLTGNDDEINLNGDGSEKPEFGEWTWMTPKEVIEKAVDFKKPVYE 151

Query: 222 KVLEAFAPTLKWDSGGIS 275
+ L+ FAP L+ D S
Sbjct: 152 EALKHFAPYLQSDPAASS 169



Score = 26.2 bits (56), Expect(2) = 7e-22
Identities = 11/16 (68%), Positives = 14/16 (87%), Gaps = 1/16 (6%)
Frame = +1

Query: 1 YDFPPDVRIKIH-RYG 45
YDFPPDVR K++ R+G
Sbjct: 78 YDFPPDVRTKLNARWG 93


>tr|B6TIH5|B6TIH5_MAIZE Putative uncharacterized protein OS=Zea mays
PE=2 SV=1
Length = 233

Score = 100 bits (250), Expect(2) = 5e-21
Identities = 44/78 (56%), Positives = 56/78 (71%)
Frame = +3

Query: 42 WGKEWTGQAQKWFLFRFKGDEKEINLNVNGIERAEFSDWKWASANEVLGRAVDFKKPVYE 221
WG +W GQAQKWFLFR G++ EINLN +G E+ EF +W W + EV+ +AVDFKKPVYE
Sbjct: 156 WGTDWKGQAQKWFLFRLTGNDDEINLNGDGSEKPEFGEWTWMTPKEVIEKAVDFKKPVYE 215

Query: 222 KVLEAFAPTLKWDSGGIS 275
+ L+ FAP L+ D S
Sbjct: 216 EALKHFAPYLQSDPAASS 233



Score = 23.1 bits (48), Expect(2) = 5e-21
Identities = 10/16 (62%), Positives = 13/16 (81%), Gaps = 1/16 (6%)
Frame = +1

Query: 1 YDFPPDVRIKIH-RYG 45
YDFP DVR K++ R+G
Sbjct: 142 YDFPTDVRTKLNPRWG 157


>tr|A9NP51|A9NP51_PICSI Putative uncharacterized protein OS=Picea
sitchensis PE=2 SV=1
Length = 167

Score = 103 bits (257), Expect = 6e-21
Identities = 44/77 (57%), Positives = 58/77 (75%)
Frame = +3

Query: 21 EDKDSQIWGKEWTGQAQKWFLFRFKGDEKEINLNVNGIERAEFSDWKWASANEVLGRAVD 200
++K ++WG++W GQAQKWFL +F GDEKEINL +G E AEFS+WKW +V+ + VD
Sbjct: 84 KEKLDRLWGRDWKGQAQKWFLLKFTGDEKEINLAGDGTEAAEFSEWKWMPPEQVMEQVVD 143

Query: 201 FKKPVYEKVLEAFAPTL 251
FK+PVYE+V FAP L
Sbjct: 144 FKRPVYEQVFRFFAPHL 160


>tr|B6U9P7|B6U9P7_MAIZE Putative uncharacterized protein OS=Zea mays
PE=2 SV=1
Length = 169

Score = 100 bits (250), Expect(2) = 6e-21
Identities = 44/78 (56%), Positives = 56/78 (71%)
Frame = +3

Query: 42 WGKEWTGQAQKWFLFRFKGDEKEINLNVNGIERAEFSDWKWASANEVLGRAVDFKKPVYE 221
WG +W GQAQKWFLFR G++ EINLN +G E+ EF +W W + EV+ +AVDFKKPVYE
Sbjct: 92 WGTDWKGQAQKWFLFRLTGNDDEINLNGDGSEKPEFGEWTWMTPQEVIEKAVDFKKPVYE 151

Query: 222 KVLEAFAPTLKWDSGGIS 275
+ L+ FAP L+ D S
Sbjct: 152 EALKHFAPYLQSDPAASS 169



Score = 23.1 bits (48), Expect(2) = 6e-21
Identities = 10/16 (62%), Positives = 13/16 (81%), Gaps = 1/16 (6%)
Frame = +1

Query: 1 YDFPPDVRIKIH-RYG 45
YDFP DVR K++ R+G
Sbjct: 78 YDFPTDVRTKLNARWG 93


>tr|O24005|O24005_HORVU Diadenosine 5',5'''-P1,P4-tetraphosphate
hydrolase OS=Hordeum vulgare PE=2 SV=1
Length = 218

Score = 99.0 bits (245), Expect = 1e-19
Identities = 46/90 (51%), Positives = 60/90 (66%)
Frame = +3

Query: 6 FSSRREDKDSQIWGKEWTGQAQKWFLFRFKGDEKEINLNVNGIERAEFSDWKWASANEVL 185
F + +DK + WG W GQAQKWFLFR G + EINL +G E+ EFS+W W + +V+
Sbjct: 129 FPADVKDKLNARWGTNWKGQAQKWFLFRLTGGDDEINLMGDGSEKPEFSEWAWMTPKQVI 188

Query: 186 GRAVDFKKPVYEKVLEAFAPTLKWDSGGIS 275
+AVDFKKPVYE+ L+ FAP L+ D S
Sbjct: 189 EKAVDFKKPVYEETLKHFAPYLQSDPAASS 218


>tr|Q9CAF2|Q9CAF2_ARATH Putative diadenosine
5',5'''-P1,P4-tetraphosphate hydrolase; 27094-25792
(Putative diadenosine 5',5'''-P1,P4-tetraphosphate
hydrolase) OS=Arabidopsis thaliana GN=At3g10620 PE=2
SV=1
Length = 216

Score = 92.0 bits (227), Expect(2) = 6e-19
Identities = 38/71 (53%), Positives = 53/71 (74%)
Frame = +3

Query: 42 WGKEWTGQAQKWFLFRFKGDEKEINLNVNGIERAEFSDWKWASANEVLGRAVDFKKPVYE 221
WG +W GQAQKWFL +F G ++EINL +G E+ EF +W W S ++V+ AV+FKKPVY+
Sbjct: 146 WGSDWKGQAQKWFLLKFTGKDEEINLLGDGTEKPEFGEWSWTSPDQVVENAVEFKKPVYK 205

Query: 222 KVLEAFAPTLK 254
+V+ AFA L+
Sbjct: 206 EVMSAFASHLQ 216



Score = 25.0 bits (53), Expect(2) = 6e-19
Identities = 11/17 (64%), Positives = 14/17 (82%), Gaps = 1/17 (5%)
Frame = +1

Query: 1 YDFPPDVRIKIH-RYGA 48
YDFPPDVR K+ R+G+
Sbjct: 132 YDFPPDVREKLKVRWGS 148


>tr|Q9LPN7|Q9LPN7_ARATH Diadenosine 5',5'''-P1,P4-tetraphosphate
hydrolase, putative OS=Arabidopsis thaliana GN=F18K10.24
PE=3 SV=1
Length = 205

Score = 92.0 bits (227), Expect(2) = 6e-19
Identities = 38/71 (53%), Positives = 53/71 (74%)
Frame = +3

Query: 42 WGKEWTGQAQKWFLFRFKGDEKEINLNVNGIERAEFSDWKWASANEVLGRAVDFKKPVYE 221
WG +W GQAQKWFL +F G ++EINL +G E+ EF +W W S ++V+ AV+FKKPVY+
Sbjct: 135 WGSDWKGQAQKWFLLKFTGKDEEINLLGDGTEKPEFGEWSWTSPDQVVENAVEFKKPVYK 194

Query: 222 KVLEAFAPTLK 254
+V+ AFA L+
Sbjct: 195 EVMSAFASHLQ 205



Score = 25.0 bits (53), Expect(2) = 6e-19
Identities = 11/17 (64%), Positives = 14/17 (82%), Gaps = 1/17 (5%)
Frame = +1

Query: 1 YDFPPDVRIKIH-RYGA 48
YDFPPDVR K+ R+G+
Sbjct: 121 YDFPPDVREKLKVRWGS 137


>tr|Q7XPT6|Q7XPT6_ORYSJ OSJNBa0088H09.20 protein (OSJNBa0070M12.2
protein) OS=Oryza sativa subsp. japonica
GN=OSJNBa0088H09.20 PE=3 SV=1
Length = 226

Score = 95.9 bits (237), Expect = 1e-18
Identities = 43/81 (53%), Positives = 57/81 (70%)
Frame = +3

Query: 18 REDKDSQIWGKEWTGQAQKWFLFRFKGDEKEINLNVNGIERAEFSDWKWASANEVLGRAV 197
+E +++ G W GQAQKWFLFRF G E E+NLN +G ER EF +W W + +V+ +AV
Sbjct: 139 KEKLNARWGGTNWKGQAQKWFLFRFTGKEDEVNLNGDGSERPEFCEWTWMTPQQVIEKAV 198

Query: 198 DFKKPVYEKVLEAFAPTLKWD 260
+FKKPVYE L+ FAP L+ D
Sbjct: 199 EFKKPVYEAALKHFAPYLQSD 219


>tr|Q259N5|Q259N5_ORYSA H0723C07.5 protein OS=Oryza sativa
GN=H0723C07.5 PE=3 SV=1
Length = 162

Score = 95.9 bits (237), Expect = 1e-18
Identities = 43/81 (53%), Positives = 57/81 (70%)
Frame = +3

Query: 18 REDKDSQIWGKEWTGQAQKWFLFRFKGDEKEINLNVNGIERAEFSDWKWASANEVLGRAV 197
+E +++ G W GQAQKWFLFRF G E E+NLN +G ER EF +W W + +V+ +AV
Sbjct: 75 KEKLNARWGGTNWKGQAQKWFLFRFTGKEDEVNLNGDGSERPEFCEWTWMTPQQVIEKAV 134

Query: 198 DFKKPVYEKVLEAFAPTLKWD 260
+FKKPVYE L+ FAP L+ D
Sbjct: 135 EFKKPVYEAALKHFAPYLQSD 155


>tr|Q0J8V1|Q0J8V1_ORYSJ Os04g0685800 protein (Fragment) OS=Oryza
sativa subsp. japonica GN=Os04g0685800 PE=4 SV=1
Length = 225

Score = 95.9 bits (237), Expect = 1e-18
Identities = 43/81 (53%), Positives = 57/81 (70%)
Frame = +3

Query: 18 REDKDSQIWGKEWTGQAQKWFLFRFKGDEKEINLNVNGIERAEFSDWKWASANEVLGRAV 197
+E +++ G W GQAQKWFLFRF G E E+NLN +G ER EF +W W + +V+ +AV
Sbjct: 138 KEKLNARWGGTNWKGQAQKWFLFRFTGKEDEVNLNGDGSERPEFCEWTWMTPQQVIEKAV 197

Query: 198 DFKKPVYEKVLEAFAPTLKWD 260
+FKKPVYE L+ FAP L+ D
Sbjct: 198 EFKKPVYEAALKHFAPYLQSD 218