BP917591
Clone id YMU001_000102_G10
Library
Length 423
Definition Adiantum capillus-veneris mRNA. clone: YMU001_000102_G10.
Accession
Tissue type prothallium
Developmental stage -
Contig ID -
Sequence
TGCAGAAATAGCTTCATGCGTTTGGAAGACTCCATATTGCTTTTGAGCGGCTCTAGTTGC
AATGTTTTGAGGCTTATAAATAATTCTCATATTGCAAAAAACATACACCAAATCAGCAGC
CCGTTTAGTATGAAGTCTGTTTCGCTTTTTAGAGTGCACAAAGTCGAATGCTGACCAGTT
TCGCTTACAACTTCCACTTGATGCAGCTATTGATAAAACTCTAACTACAATGTGTTGCAA
CTCCACATTCTCTCCACCATACTCCTTCCACCATAAAGGTGCACTTGTTTTGCCAATGGC
ATCTATATGCCACGGATCCTGAAACATACCATTGCTGTTGGCATAATCTACTCGCTGATG
AAAAGCCGTTTTTCCATCTTCGTGCCCTAAGAGTTGGGAGCACACTGTTTTGAAGTCGGA
CAT
■■Homology search results ■■ -
sp_hit_id Q95Q95
Definition sp|Q95Q95|TOR_CAEEL Target of rapamycin homolog OS=Caenorhabditis elegans
Align length 97
Score (bit) 35.8
E-value 0.072
Report
BLASTX 2.2.19 [Nov-02-2008]


Reference: Altschul, Stephen F., Thomas L. Madden, Alejandro A. Schaffer,
Jinghui Zhang, Zheng Zhang, Webb Miller, and David J. Lipman (1997),
"Gapped BLAST and PSI-BLAST: a new generation of protein database search
programs", Nucleic Acids Res. 25:3389-3402.

Query= BP917591|Adiantum capillus-veneris mRNA, clone:
YMU001_000102_G10.
(423 letters)

Database: uniprot_sprot.fasta
412,525 sequences; 148,809,765 total letters

Searching..................................................done



Score E
Sequences producing significant alignments: (bits) Value

sp|Q95Q95|TOR_CAEEL Target of rapamycin homolog OS=Caenorhabditi... 36 0.072
sp|P0C6F5|R1A_BC279 Replicase polyprotein 1a OS=Bat coronavirus ... 30 5.0
sp|P0C6V9|R1AB_BC279 Replicase polyprotein 1ab OS=Bat coronaviru... 30 5.0
sp|A7ME74|OPGH_ENTS8 Glucans biosynthesis glucosyltransferase H ... 30 5.2
sp|Q9MUL2|NDHI_MESVI NAD(P)H-quinone oxidoreductase subunit I, c... 30 5.2
sp|Q19V57|NDHI_CHLAT NAD(P)H-quinone oxidoreductase subunit I, c... 30 5.2
sp|P41638|RR4_PINTH 30S ribosomal protein S4, chloroplastic OS=P... 29 6.8
sp|O94596|YC86_SCHPO Putative uncharacterized membrane protein C... 29 8.6
sp|A4FWZ9|TDXH_METM5 Probable peroxiredoxin OS=Methanococcus mar... 29 8.8
sp|A5UNI4|ATGT_METS3 7-cyano-7-deazaguanine tRNA-ribosyltransfer... 29 8.8

>sp|Q95Q95|TOR_CAEEL Target of rapamycin homolog OS=Caenorhabditis
elegans GN=let-363 PE=2 SV=3
Length = 2697

Score = 35.8 bits (81), Expect = 0.072
Identities = 27/97 (27%), Positives = 45/97 (46%), Gaps = 5/97 (5%)
Frame = -1

Query: 363 FHQRVDYANSNGMFQDPWHIDAIGKTSAPLWWKEYGGENVELQHI--VVRVLSIAASSGS 190
FH+R+ N MF +++ + + AP KE+ + + R + SSG+
Sbjct: 2210 FHRRLQDNNVQAMFDALRNMNDLMQKGAPTTMKEHSFQQTYSSDLKEAGRYVQAFESSGN 2269

Query: 189 CK---RNWSAFDFVHSKKRNRLHTKRAADLVYVFCNM 88
K + W + V K R++L T + DLVYV N+
Sbjct: 2270 VKDLNQAWEIYCSVFKKLRDQLATLNSLDLVYVSPNL 2306


>sp|P0C6F5|R1A_BC279 Replicase polyprotein 1a OS=Bat coronavirus
279/2005 GN=1a PE=3 SV=1
Length = 4388

Score = 29.6 bits (65), Expect = 5.0
Identities = 22/82 (26%), Positives = 35/82 (42%), Gaps = 6/82 (7%)
Frame = +2

Query: 92 LQKTYTKSAARLV*SLFRFLECTKSNADQFRLQLPLDAA------IDKTLTTMCCNSTFS 253
+Q+ + ++ LF+ T+S + R LP A + K +C N S
Sbjct: 2144 VQRVFNNYMPYVITLLFQLCTFTRSTNSRIRASLPTTIAKNSVKSVAKLCLDVCINYVKS 2203

Query: 254 PPYSFHHKGALVLPMASICHGS 319
P +S A+ L + SIC GS
Sbjct: 2204 PKFSKLFTIAMWLLLLSICLGS 2225


>sp|P0C6V9|R1AB_BC279 Replicase polyprotein 1ab OS=Bat coronavirus
279/2005 GN=rep PE=3 SV=1
Length = 7079

Score = 29.6 bits (65), Expect = 5.0
Identities = 22/82 (26%), Positives = 35/82 (42%), Gaps = 6/82 (7%)
Frame = +2

Query: 92 LQKTYTKSAARLV*SLFRFLECTKSNADQFRLQLPLDAA------IDKTLTTMCCNSTFS 253
+Q+ + ++ LF+ T+S + R LP A + K +C N S
Sbjct: 2144 VQRVFNNYMPYVITLLFQLCTFTRSTNSRIRASLPTTIAKNSVKSVAKLCLDVCINYVKS 2203

Query: 254 PPYSFHHKGALVLPMASICHGS 319
P +S A+ L + SIC GS
Sbjct: 2204 PKFSKLFTIAMWLLLLSICLGS 2225


>sp|A7ME74|OPGH_ENTS8 Glucans biosynthesis glucosyltransferase H
OS=Enterobacter sakazakii (strain ATCC BAA-894) GN=mdoH
PE=3 SV=1
Length = 842

Score = 29.6 bits (65), Expect = 5.2
Identities = 16/51 (31%), Positives = 25/51 (49%)
Frame = -1

Query: 396 QLLGHEDGKTAFHQRVDYANSNGMFQDPWHIDAIGKTSAPLWWKEYGGENV 244
QL+ ++G+T Q + A + MF DPW + IG+ +W G V
Sbjct: 67 QLIKDDEGRTQI-QAMPKATRSSMFPDPWRTNPIGR-----FWDRLRGREV 111


>sp|Q9MUL2|NDHI_MESVI NAD(P)H-quinone oxidoreductase subunit I,
chloroplastic OS=Mesostigma viride GN=ndhI PE=3 SV=1
Length = 176

Score = 29.6 bits (65), Expect = 5.2
Identities = 16/56 (28%), Positives = 25/56 (44%)
Frame = -1

Query: 180 NWSAFDFVHSKKRNRLHTKRAADLVYVFCNMRIIYKPQNIATRAAQKQYGVFQTHE 13
NW +F KK+ +L T V +FC + Y P N + + + V+ HE
Sbjct: 82 NW---EFQKEKKKKQLQTYSIDFGVCIFCGNCVEYCPTNCLSMTEEYELSVYDRHE 134


>sp|Q19V57|NDHI_CHLAT NAD(P)H-quinone oxidoreductase subunit I,
chloroplastic OS=Chlorokybus atmophyticus GN=ndhI PE=3
SV=2
Length = 175

Score = 29.6 bits (65), Expect = 5.2
Identities = 16/56 (28%), Positives = 25/56 (44%)
Frame = -1

Query: 180 NWSAFDFVHSKKRNRLHTKRAADLVYVFCNMRIIYKPQNIATRAAQKQYGVFQTHE 13
NW +F KK+ +L T V +FC + Y P N + + + V+ HE
Sbjct: 82 NW---EFQKEKKKKQLQTYSIDFGVCIFCGNCVEYCPTNCLSMTEEYELSVYDRHE 134


>sp|P41638|RR4_PINTH 30S ribosomal protein S4, chloroplastic
OS=Pinus thunbergii GN=rps4 PE=3 SV=1
Length = 198

Score = 29.3 bits (64), Expect = 6.8
Identities = 13/36 (36%), Positives = 20/36 (55%)
Frame = +1

Query: 16 MRLEDSILLLSGSSCNVLRLINNSHIAKNIHQISSP 123
MRL+ S + GS+ +L+N+ HI N H + P
Sbjct: 88 MRLDKSFSIGYGSTSGARQLVNHGHIRVNDHMVDIP 123


>sp|O94596|YC86_SCHPO Putative uncharacterized membrane protein
C622.06c OS=Schizosaccharomyces pombe GN=SPCC622.06c
PE=2 SV=1
Length = 122

Score = 28.9 bits (63), Expect = 8.6
Identities = 13/54 (24%), Positives = 32/54 (59%), Gaps = 4/54 (7%)
Frame = -2

Query: 167 STLCTLKSETDFILNGLLIWC----MFFAI*ELFISLKTLQLEPLKSNMESSKR 18
+T C L + D I+N + + C ++F+ +L + ++ ++E ++N+E ++R
Sbjct: 69 NTYCELPAVADAIINSIALVCIIVILYFSSRKLNVEIRRGEVEDYRANLERNQR 122


>sp|A4FWZ9|TDXH_METM5 Probable peroxiredoxin OS=Methanococcus
maripaludis (strain C5 / ATCC BAA-1333) GN=MmarC5_0413
PE=3 SV=1
Length = 217

Score = 28.9 bits (63), Expect = 8.8
Identities = 18/77 (23%), Positives = 35/77 (45%), Gaps = 11/77 (14%)
Frame = -1

Query: 306 IDAIGKTSAPLWWKEYGGENVELQHIVVRVLSIAASSGSCKRNWSAFDFVHSK------- 148
+DA G A +++ + G N++ +V+ L A + NW DF++ K
Sbjct: 127 VDATGTIRAIIYYPQEVGRNMDEVVRLVKALQTADKGYATPANWPENDFLNEKVIVPPAN 186

Query: 147 ----KRNRLHTKRAADL 109
++NRL ++ +L
Sbjct: 187 NMDARKNRLEACKSGEL 203


>sp|A5UNI4|ATGT_METS3 7-cyano-7-deazaguanine tRNA-ribosyltransferase
OS=Methanobrevibacter smithii (strain PS / ATCC 35061 /
DSM 861) GN=tgtA PE=3 SV=1
Length = 659

Score = 28.9 bits (63), Expect = 8.8
Identities = 20/55 (36%), Positives = 28/55 (50%), Gaps = 3/55 (5%)
Frame = +1

Query: 16 MRLEDSILLLSGSSCNVLRLINNSHIAKN---IHQISSPFSMKSVSLFRVHKVEC 171
MR DS L+LS RL + KN +++ S PFS++ S+F VEC
Sbjct: 558 MRASDSFLILSKEGAK--RLHAATQYPKNRVVVNKDSEPFSLEGKSVFAKFVVEC 610


tr_hit_id A5B9K5
Definition tr|A5B9K5|A5B9K5_VITVI Putative uncharacterized protein OS=Vitis vinifera
Align length 116
Score (bit) 81.6
E-value 2.0e-14
Report
BLASTX 2.2.19 [Nov-02-2008]


Reference: Altschul, Stephen F., Thomas L. Madden, Alejandro A. Schaffer,
Jinghui Zhang, Zheng Zhang, Webb Miller, and David J. Lipman (1997),
"Gapped BLAST and PSI-BLAST: a new generation of protein database search
programs", Nucleic Acids Res. 25:3389-3402.

Query= BP917591|Adiantum capillus-veneris mRNA, clone:
YMU001_000102_G10.
(423 letters)

Database: uniprot_trembl.fasta
7,341,751 sequences; 2,391,615,440 total letters

Searching..................................................done



Score E
Sequences producing significant alignments: (bits) Value

tr|A5B9K5|A5B9K5_VITVI Putative uncharacterized protein OS=Vitis... 82 2e-14
tr|A7PFQ4|A7PFQ4_VITVI Chromosome chr11 scaffold_14, whole genom... 81 2e-14
tr|A5AL34|A5AL34_VITVI Putative uncharacterized protein OS=Vitis... 81 3e-14
tr|A7QKN8|A7QKN8_VITVI Chromosome chr2 scaffold_113, whole genom... 80 4e-14
tr|A7QJZ0|A7QJZ0_VITVI Chromosome undetermined scaffold_109, who... 80 4e-14
tr|A7P6V7|A7P6V7_VITVI Chromosome chr9 scaffold_7, whole genome ... 80 4e-14
tr|A5AH12|A5AH12_VITVI Putative uncharacterized protein OS=Vitis... 80 4e-14
tr|A5AXS2|A5AXS2_VITVI Putative uncharacterized protein OS=Vitis... 80 5e-14
tr|Q2QP98|Q2QP98_ORYSJ HAT family dimerisation domain containing... 79 1e-13
tr|A7QML5|A7QML5_VITVI Chromosome chr19 scaffold_126, whole geno... 79 1e-13
tr|A5BG18|A5BG18_VITVI Putative uncharacterized protein OS=Vitis... 78 2e-13
tr|A5BC22|A5BC22_VITVI Putative uncharacterized protein OS=Vitis... 78 2e-13
tr|Q2QP95|Q2QP95_ORYSJ HAT family dimerisation domain containing... 77 3e-13
tr|A5ART1|A5ART1_VITVI Putative uncharacterized protein OS=Vitis... 77 6e-13
tr|O81190|O81190_ARATH Putative transposase OS=Arabidopsis thali... 76 9e-13
tr|A7Q530|A7Q530_VITVI Chromosome undetermined scaffold_51, whol... 75 1e-12
tr|A5B2A7|A5B2A7_VITVI Putative uncharacterized protein OS=Vitis... 75 1e-12
tr|A5AYJ1|A5AYJ1_VITVI Putative uncharacterized protein OS=Vitis... 75 1e-12
tr|A5AWE7|A5AWE7_VITVI Putative uncharacterized protein OS=Vitis... 75 1e-12
tr|Q8S658|Q8S658_ORYSA Putative transposable element OS=Oryza sa... 75 2e-12
tr|Q7XFV9|Q7XFV9_ORYSJ HAT family dimerisation domain containing... 75 2e-12
tr|A5BVC8|A5BVC8_VITVI Putative uncharacterized protein OS=Vitis... 75 2e-12
tr|A7QME1|A7QME1_VITVI Chromosome undetermined scaffold_125, who... 74 3e-12
tr|A5AX25|A5AX25_VITVI Putative uncharacterized protein OS=Vitis... 74 3e-12
tr|A7QZI0|A7QZI0_VITVI Chromosome chr7 scaffold_275, whole genom... 74 5e-12
tr|A7QT07|A7QT07_VITVI Chromosome chr14 scaffold_164, whole geno... 74 5e-12
tr|A5C861|A5C861_VITVI Putative uncharacterized protein OS=Vitis... 73 6e-12
tr|A5C5L6|A5C5L6_VITVI Putative uncharacterized protein OS=Vitis... 73 6e-12
tr|A5AU36|A5AU36_VITVI Putative uncharacterized protein OS=Vitis... 73 6e-12
tr|A7PKN6|A7PKN6_VITVI Chromosome chr7 scaffold_20, whole genome... 73 8e-12

>tr|A5B9K5|A5B9K5_VITVI Putative uncharacterized protein OS=Vitis
vinifera GN=VITISV_032284 PE=4 SV=1
Length = 580

Score = 81.6 bits (200), Expect = 2e-14
Identities = 43/116 (37%), Positives = 64/116 (55%), Gaps = 4/116 (3%)
Frame = -1

Query: 396 QLLGHEDGKTAFHQRVDYANSNGMFQDPWHIDAIGKTSAPLWWKEYGGENVELQHIVVRV 217
++L +++ A Q Y + G F ID+ S WW +GG +ELQ +RV
Sbjct: 340 RMLDYQERLKANIQLDSYDQAMGEFGSRIAIDSRTLRSPTSWWMRFGGSTLELQKFAIRV 399

Query: 216 LSIAASSGSCKRNWSAFDFVHSKKRNRLHTKRAADLVYVFCNMRI----IYKPQNI 61
LS+ S+ C+RNWS F+ +H+KKRNRL +R LVYV N R+ + + QN+
Sbjct: 400 LSLTCSASGCERNWSTFESIHTKKRNRLEHQRLNALVYVRYNTRLRERSLQRKQNV 455


>tr|A7PFQ4|A7PFQ4_VITVI Chromosome chr11 scaffold_14, whole genome
shotgun sequence OS=Vitis vinifera GN=GSVIVT00017198001
PE=4 SV=1
Length = 124

Score = 81.3 bits (199), Expect = 2e-14
Identities = 40/91 (43%), Positives = 53/91 (58%)
Frame = -1

Query: 354 RVDYANSNGMFQDPWHIDAIGKTSAPLWWKEYGGENVELQHIVVRVLSIAASSGSCKRNW 175
R Y+ + G F ID+ S WW +GG ELQ V+RVLS+ S+ C+RNW
Sbjct: 32 RFMYSKAMGEFGSRIAIDSRTLRSPTSWWMRFGGSTPELQKFVIRVLSLTCSASGCERNW 91

Query: 174 SAFDFVHSKKRNRLHTKRAADLVYVFCNMRI 82
S F+ +H+KKRNRL +R LVYV N R+
Sbjct: 92 STFESIHTKKRNRLEHQRLNALVYVRYNTRL 122


>tr|A5AL34|A5AL34_VITVI Putative uncharacterized protein OS=Vitis
vinifera GN=VITISV_031335 PE=4 SV=1
Length = 1861

Score = 80.9 bits (198), Expect = 3e-14
Identities = 43/116 (37%), Positives = 63/116 (54%), Gaps = 4/116 (3%)
Frame = -1

Query: 396 QLLGHEDGKTAFHQRVDYANSNGMFQDPWHIDAIGKTSAPLWWKEYGGENVELQHIVVRV 217
++L +++ A Q Y + G F ID+ S WW +GG ELQ +RV
Sbjct: 1490 RMLDYQERLKADIQLDSYDQAMGEFGSRIXIDSRTLRSPTSWWMRFGGSXXELQKFAIRV 1549

Query: 216 LSIAASSGSCKRNWSAFDFVHSKKRNRLHTKRAADLVYVFCNMRI----IYKPQNI 61
LS+ S+ C+RNWS F+ +H+KKRNRL +R LVYV N R+ + + QN+
Sbjct: 1550 LSLTCSASGCERNWSTFESIHTKKRNRLEHQRLNALVYVRYNTRLRERSLQRKQNV 1605


>tr|A7QKN8|A7QKN8_VITVI Chromosome chr2 scaffold_113, whole genome
shotgun sequence OS=Vitis vinifera GN=GSVIVT00001200001
PE=4 SV=1
Length = 347

Score = 80.5 bits (197), Expect = 4e-14
Identities = 43/116 (37%), Positives = 63/116 (54%), Gaps = 4/116 (3%)
Frame = -1

Query: 396 QLLGHEDGKTAFHQRVDYANSNGMFQDPWHIDAIGKTSAPLWWKEYGGENVELQHIVVRV 217
++L +++ A Q Y + G F ID+ S WW +GG ELQ +RV
Sbjct: 137 RMLDYQERLKADIQLDSYDQAMGEFGSRIAIDSRTLRSPTSWWMRFGGSTPELQKFAIRV 196

Query: 216 LSIAASSGSCKRNWSAFDFVHSKKRNRLHTKRAADLVYVFCNMRI----IYKPQNI 61
LS+ S+ C+RNWS F+ +H+KKRNRL +R LVYV N R+ + + QN+
Sbjct: 197 LSLTCSASGCERNWSTFESIHTKKRNRLEHQRLNALVYVRYNTRLRERSLQRKQNV 252


>tr|A7QJZ0|A7QJZ0_VITVI Chromosome undetermined scaffold_109, whole
genome shotgun sequence OS=Vitis vinifera
GN=GSVIVT00000858001 PE=4 SV=1
Length = 644

Score = 80.5 bits (197), Expect = 4e-14
Identities = 43/116 (37%), Positives = 63/116 (54%), Gaps = 4/116 (3%)
Frame = -1

Query: 396 QLLGHEDGKTAFHQRVDYANSNGMFQDPWHIDAIGKTSAPLWWKEYGGENVELQHIVVRV 217
++L +++ A Q Y + G F ID+ S WW +GG ELQ +RV
Sbjct: 404 RMLDYQERLKADIQLDSYDQAMGEFGSRIAIDSRTLRSPTSWWMRFGGSTPELQKFAIRV 463

Query: 216 LSIAASSGSCKRNWSAFDFVHSKKRNRLHTKRAADLVYVFCNMRI----IYKPQNI 61
LS+ S+ C+RNWS F+ +H+KKRNRL +R LVYV N R+ + + QN+
Sbjct: 464 LSLTCSASGCERNWSTFESIHTKKRNRLEHQRLNALVYVRYNTRLRERSLQRKQNV 519


>tr|A7P6V7|A7P6V7_VITVI Chromosome chr9 scaffold_7, whole genome
shotgun sequence OS=Vitis vinifera GN=GSVIVT00034220001
PE=4 SV=1
Length = 452

Score = 80.5 bits (197), Expect = 4e-14
Identities = 43/116 (37%), Positives = 63/116 (54%), Gaps = 4/116 (3%)
Frame = -1

Query: 396 QLLGHEDGKTAFHQRVDYANSNGMFQDPWHIDAIGKTSAPLWWKEYGGENVELQHIVVRV 217
++L +++ A Q Y + G F ID+ S WW +GG ELQ +RV
Sbjct: 212 RMLDYQERLKADIQLDSYDQAMGEFGSRIAIDSRTLRSPTSWWMRFGGSTPELQKFAIRV 271

Query: 216 LSIAASSGSCKRNWSAFDFVHSKKRNRLHTKRAADLVYVFCNMRI----IYKPQNI 61
LS+ S+ C+RNWS F+ +H+KKRNRL +R LVYV N R+ + + QN+
Sbjct: 272 LSLTCSASGCERNWSTFESIHTKKRNRLEHQRLNALVYVRYNTRLRERSLQRKQNV 327


>tr|A5AH12|A5AH12_VITVI Putative uncharacterized protein OS=Vitis
vinifera GN=VITISV_035916 PE=4 SV=1
Length = 710

Score = 80.5 bits (197), Expect = 4e-14
Identities = 43/116 (37%), Positives = 63/116 (54%), Gaps = 4/116 (3%)
Frame = -1

Query: 396 QLLGHEDGKTAFHQRVDYANSNGMFQDPWHIDAIGKTSAPLWWKEYGGENVELQHIVVRV 217
++L +++ A Q Y + G F ID+ S WW +GG ELQ +RV
Sbjct: 470 RMLDYQERLKADIQLDSYDQAMGEFGSRIAIDSRTLRSPTSWWMRFGGSTPELQKFAIRV 529

Query: 216 LSIAASSGSCKRNWSAFDFVHSKKRNRLHTKRAADLVYVFCNMRI----IYKPQNI 61
LS+ S+ C+RNWS F+ +H+KKRNRL +R LVYV N R+ + + QN+
Sbjct: 530 LSLTCSASGCERNWSTFESIHTKKRNRLEHQRLNALVYVRYNTRLRERSLQRKQNV 585


>tr|A5AXS2|A5AXS2_VITVI Putative uncharacterized protein OS=Vitis
vinifera GN=VITISV_016801 PE=4 SV=1
Length = 689

Score = 80.1 bits (196), Expect = 5e-14
Identities = 43/116 (37%), Positives = 63/116 (54%), Gaps = 4/116 (3%)
Frame = -1

Query: 396 QLLGHEDGKTAFHQRVDYANSNGMFQDPWHIDAIGKTSAPLWWKEYGGENVELQHIVVRV 217
++L +++ A Q Y + G F ID+ S WW +GG ELQ +RV
Sbjct: 526 RMLDYQERLKADIQLDSYDQAMGEFGSCIAIDSRTLRSPTSWWMRFGGSTPELQKFAIRV 585

Query: 216 LSIAASSGSCKRNWSAFDFVHSKKRNRLHTKRAADLVYVFCNMRI----IYKPQNI 61
LS+ S+ C+RNWS F+ +H+KKRNRL +R LVYV N R+ + + QN+
Sbjct: 586 LSLTCSASGCERNWSTFESIHTKKRNRLEHQRLNALVYVRYNTRLRERSLQRKQNV 641


>tr|Q2QP98|Q2QP98_ORYSJ HAT family dimerisation domain containing
protein OS=Oryza sativa subsp. japonica
GN=LOC_Os12g35220 PE=4 SV=1
Length = 820

Score = 79.0 bits (193), Expect = 1e-13
Identities = 40/112 (35%), Positives = 60/112 (53%)
Frame = -1

Query: 372 KTAFHQRVDYANSNGMFQDPWHIDAIGKTSAPLWWKEYGGENVELQHIVVRVLSIAASSG 193
KT H Y N + + I++ G A WW +G L+ + R+LS+ SS
Sbjct: 603 KTPLHLAGYYLNPYYYYPNKQEIESDGSFRAAKWWLNHGTSTPNLRKLAARILSLTCSSS 662

Query: 192 SCKRNWSAFDFVHSKKRNRLHTKRAADLVYVFCNMRIIYKPQNIATRAAQKQ 37
+C+RNWS F+ VH+KKRNRL +R DLV+V N ++ K +N +K+
Sbjct: 663 ACERNWSVFEQVHTKKRNRLLHERMRDLVFVKFNSKLRNKRENKGRDPIEKE 714


>tr|A7QML5|A7QML5_VITVI Chromosome chr19 scaffold_126, whole genome
shotgun sequence OS=Vitis vinifera GN=GSVIVT00002113001
PE=4 SV=1
Length = 249

Score = 79.0 bits (193), Expect = 1e-13
Identities = 42/115 (36%), Positives = 63/115 (54%), Gaps = 1/115 (0%)
Frame = -1

Query: 345 YANSNGMFQDPWHIDAIGKTSAPL-WWKEYGGENVELQHIVVRVLSIAASSGSCKRNWSA 169
Y N+ G+F++ + KT AP WW YG LQ ++VL++ S+ C+RNWS
Sbjct: 28 YTNAQGLFENELAVKT-RKTRAPAEWWAAYGASAPNLQRFAIKVLNLTCSASGCERNWSI 86

Query: 168 FDFVHSKKRNRLHTKRAADLVYVFCNMRIIYKPQNIATRAAQKQYGVFQTHEAIS 4
F+ +HSK+RNRL+ +R DL+Y+ N RA +K+Y T + IS
Sbjct: 87 FENIHSKRRNRLNHQRLNDLIYIKYN------------RALKKRYNERNTIDRIS 129