BP917601
Clone id YMU001_000102_H10
Library
Length 232
Definition Adiantum capillus-veneris mRNA. clone: YMU001_000102_H10.
Accession
Tissue type prothallium
Developmental stage -
Contig ID
Sequence
ATGTCGAGAAACCCTACCAGCCAACTCAGGAGCTGGAATATGATTCAGGATGCTCGCTGT
ACATTTTTCTGATGCATTCTCCTCATCGCTATCAGAGGAAATGCTGCCTGTTGTGCATTT
CTGGATACCCTCGGTGTGCCTTGATTCACCATGATGGCGACAATTCGTCATACATGTCAT
GGTGCTCGTACCACAGCTACCCTTTAGAACGCAACCACTTTGGACAAGCGTT
■■Homology search results ■■ -
sp_hit_id Q10063
Definition sp|Q10063|EHS1_SCHPO Calcium influx-promoting protein ehs1 OS=Schizosaccharomyces pombe
Align length 33
Score (bit) 30.4
E-value 2.9
Report
BLASTX 2.2.19 [Nov-02-2008]


Reference: Altschul, Stephen F., Thomas L. Madden, Alejandro A. Schaffer,
Jinghui Zhang, Zheng Zhang, Webb Miller, and David J. Lipman (1997),
"Gapped BLAST and PSI-BLAST: a new generation of protein database search
programs", Nucleic Acids Res. 25:3389-3402.

Query= BP917601|Adiantum capillus-veneris mRNA, clone:
YMU001_000102_H10.
(232 letters)

Database: uniprot_sprot.fasta
412,525 sequences; 148,809,765 total letters

Searching..................................................done



Score E
Sequences producing significant alignments: (bits) Value

sp|Q10063|EHS1_SCHPO Calcium influx-promoting protein ehs1 OS=Sc... 30 2.9
sp|Q9NXL9|MCM9_HUMAN DNA replication licensing factor MCM9 OS=Ho... 30 4.9
sp|Q5HZW5|CD320_RAT CD320 antigen OS=Rattus norvegicus GN=Cd320 ... 29 8.4
sp|Q5NVP9|MO4L1_PONAB Mortality factor 4-like protein 1 OS=Pongo... 29 8.5
sp|Q8AWZ2|HXA3A_DANRE Homeobox protein Hox-A3a OS=Danio rerio GN... 29 8.5

>sp|Q10063|EHS1_SCHPO Calcium influx-promoting protein ehs1
OS=Schizosaccharomyces pombe GN=ehs1 PE=2 SV=1
Length = 486

Score = 30.4 bits (67), Expect = 2.9
Identities = 18/33 (54%), Positives = 22/33 (66%), Gaps = 1/33 (3%)
Frame = +3

Query: 111 LCISGYPRCALIHHDGDNSSYMSWCSYHS-YPL 206
LC S PRCA I+ DNSSY+ + +Y S YPL
Sbjct: 365 LCASVIPRCADIN---DNSSYLIYKNYDSRYPL 394


>sp|Q9NXL9|MCM9_HUMAN DNA replication licensing factor MCM9 OS=Homo
sapiens GN=MCM9 PE=2 SV=3
Length = 1143

Score = 29.6 bits (65), Expect = 4.9
Identities = 16/47 (34%), Positives = 23/47 (48%), Gaps = 7/47 (14%)
Frame = -2

Query: 219 SGCVLKGSCGTSTMTCM-------TNCRHHGESRHTEGIQKCTTGSI 100
S C SC +S TC+ T CR + E + E +Q+ + GSI
Sbjct: 170 SSCPSLESCDSSKFTCLSGLSSSPTRCRDYQEIKIQEQVQRLSVGSI 216


>sp|Q5HZW5|CD320_RAT CD320 antigen OS=Rattus norvegicus GN=Cd320
PE=2 SV=1
Length = 264

Score = 28.9 bits (63), Expect = 8.4
Identities = 20/57 (35%), Positives = 26/57 (45%)
Frame = -2

Query: 231 TLVQSGCVLKGSCGTSTMTCMTNCRHHGESRHTEGIQKCTTGSISSDSDEENASEKC 61
TLVQ GSC T T C+T+ S +G + C+ GS +EE E C
Sbjct: 39 TLVQVSGPRAGSCPTDTFKCLTSGYCVPLSWRCDGDRDCSDGS----DEEECRIEPC 91


>sp|Q5NVP9|MO4L1_PONAB Mortality factor 4-like protein 1 OS=Pongo
abelii GN=MORF4L1 PE=2 SV=1
Length = 323

Score = 28.9 bits (63), Expect = 8.5
Identities = 12/40 (30%), Positives = 17/40 (42%)
Frame = +3

Query: 63 IFLMHSPHRYQRKCCLLCISGYPRCALIHHDGDNSSYMSW 182
+ H P Y+ KC + I IHH G N ++ W
Sbjct: 17 VLCFHGPLLYEAKCVKVAIKDKQVKYFIHHSGWNKNWDEW 56


>sp|Q8AWZ2|HXA3A_DANRE Homeobox protein Hox-A3a OS=Danio rerio
GN=hoxa3a PE=2 SV=1
Length = 410

Score = 28.9 bits (63), Expect = 8.5
Identities = 12/34 (35%), Positives = 16/34 (47%)
Frame = +3

Query: 12 PYQPTQELEYDSGCSLYIFLMHSPHRYQRKCCLL 113
PYQ L YD+ Y+ +H+ Y R C L
Sbjct: 17 PYQSANGLGYDASQQQYLQALHAESEYHRPACSL 50


tr_hit_id Q4N4P8
Definition tr|Q4N4P8|Q4N4P8_THEPA Putative uncharacterized protein OS=Theileria parva
Align length 50
Score (bit) 33.5
E-value 5.4
Report
BLASTX 2.2.19 [Nov-02-2008]


Reference: Altschul, Stephen F., Thomas L. Madden, Alejandro A. Schaffer,
Jinghui Zhang, Zheng Zhang, Webb Miller, and David J. Lipman (1997),
"Gapped BLAST and PSI-BLAST: a new generation of protein database search
programs", Nucleic Acids Res. 25:3389-3402.

Query= BP917601|Adiantum capillus-veneris mRNA, clone:
YMU001_000102_H10.
(232 letters)

Database: uniprot_trembl.fasta
7,341,751 sequences; 2,391,615,440 total letters

Searching..................................................done



Score E
Sequences producing significant alignments: (bits) Value

tr|Q4N4P8|Q4N4P8_THEPA Putative uncharacterized protein OS=Theil... 33 5.4

>tr|Q4N4P8|Q4N4P8_THEPA Putative uncharacterized protein
OS=Theileria parva GN=TP02_0592 PE=4 SV=1
Length = 1057

Score = 33.5 bits (75), Expect = 5.4
Identities = 18/50 (36%), Positives = 21/50 (42%)
Frame = -2

Query: 213 CVLKGSCGTSTMTCMTNCRHHGESRHTEGIQKCTTGSISSDSDEENASEK 64
C+ CG TC TNC H + KC +SDSD E EK
Sbjct: 530 CIKFCCCGDKCPTCQTNC-------HCKITTKCQPNGGTSDSDSEKIKEK 572