BP917608
Clone id YMU001_000103_A09
Library
Length 303
Definition Adiantum capillus-veneris mRNA. clone: YMU001_000103_A09.
Accession
Tissue type prothallium
Developmental stage -
Contig ID -
Sequence
GTGATGACGACAATAGAGCTGTGAGGGATATGAGGCAGGAGCGGTTCATTGAAAGAGGTC
GGTGTGATAGTGATGACGACAATAGAGCTGTGAGGGATATGAGACGAGGTGAGCTCCTAA
AGGACGTGGCGGTGCAGGTCGGAGGAGAGACCAAGGAGATCTCCTGCGAGGCTGGAGGCT
ACTATGGTCAGAGAGTTCTTGGCTCCCTTGGTCTTCATGATTGGATTTCTCCCATTAATC
TAATAGTGCGGCTTCATAAGAGATCCATATCCTACCTTAATGTATCACATAGAGATTGGA
TGG
■■Homology search results ■■ -
sp_hit_id Q1GT23
Definition sp|Q1GT23|RPOB_SPHAL DNA-directed RNA polymerase subunit beta OS=Sphingopyxis alaskensis
Align length 74
Score (bit) 29.3
E-value 6.4
Report
BLASTX 2.2.19 [Nov-02-2008]


Reference: Altschul, Stephen F., Thomas L. Madden, Alejandro A. Schaffer,
Jinghui Zhang, Zheng Zhang, Webb Miller, and David J. Lipman (1997),
"Gapped BLAST and PSI-BLAST: a new generation of protein database search
programs", Nucleic Acids Res. 25:3389-3402.

Query= BP917608|Adiantum capillus-veneris mRNA, clone:
YMU001_000103_A09.
(303 letters)

Database: uniprot_sprot.fasta
412,525 sequences; 148,809,765 total letters

Searching..................................................done



Score E
Sequences producing significant alignments: (bits) Value

sp|Q1GT23|RPOB_SPHAL DNA-directed RNA polymerase subunit beta OS... 29 6.4
sp|P44680|Y387_HAEIN Probable ATP-dependent helicase HI0387 OS=H... 29 8.4

>sp|Q1GT23|RPOB_SPHAL DNA-directed RNA polymerase subunit beta
OS=Sphingopyxis alaskensis GN=rpoB PE=3 SV=1
Length = 1392

Score = 29.3 bits (64), Expect = 6.4
Identities = 23/74 (31%), Positives = 34/74 (45%)
Frame = +3

Query: 3 DDDNRAVRDMRQERFIERGRCDSDDDNRAVRDMRRGELLKDVAVQVGGETKEISCEAGGY 182
D D RA+ R+E IER + D+DD+ RA+ + LKD+ V + G
Sbjct: 954 DKDERAIAIEREE--IERLKQDADDE-RAILNRATFSSLKDLLVGQATSAVPKGLKKGDI 1010

Query: 183 YGQRVLGSLGLHDW 224
+ +L L DW
Sbjct: 1011 VTEEMLVGLDRADW 1024


>sp|P44680|Y387_HAEIN Probable ATP-dependent helicase HI0387
OS=Haemophilus influenzae GN=HI0387 PE=3 SV=1
Length = 640

Score = 28.9 bits (63), Expect = 8.4
Identities = 19/67 (28%), Positives = 32/67 (47%)
Frame = +3

Query: 87 AVRDMRRGELLKDVAVQVGGETKEISCEAGGYYGQRVLGSLGLHDWISPINLIVRLHKRS 266
AV++ GEL+ + V + E ++ A Y+GQ L S L D IN++ R +
Sbjct: 212 AVKESGFGELIPNAEVIIFDEAHQLPDIASQYFGQS-LTSRQLFDLCKDINIVYRTELKD 270

Query: 267 ISYLNVS 287
+ L +
Sbjct: 271 MQQLGTT 277


tr_hit_id Q7RN75
Definition tr|Q7RN75|Q7RN75_PLAYO Putative uncharacterized protein PY01947 OS=Plasmodium yoelii yoelii
Align length 53
Score (bit) 34.3
E-value 3.1
Report
BLASTX 2.2.19 [Nov-02-2008]


Reference: Altschul, Stephen F., Thomas L. Madden, Alejandro A. Schaffer,
Jinghui Zhang, Zheng Zhang, Webb Miller, and David J. Lipman (1997),
"Gapped BLAST and PSI-BLAST: a new generation of protein database search
programs", Nucleic Acids Res. 25:3389-3402.

Query= BP917608|Adiantum capillus-veneris mRNA, clone:
YMU001_000103_A09.
(303 letters)

Database: uniprot_trembl.fasta
7,341,751 sequences; 2,391,615,440 total letters

Searching..................................................done



Score E
Sequences producing significant alignments: (bits) Value

tr|Q7RN75|Q7RN75_PLAYO Putative uncharacterized protein PY01947 ... 34 3.1
tr|Q4FAB4|Q4FAB4_TOXGO ATP-binding cassette sub-family B member ... 33 7.0
tr|B6KHJ2|B6KHJ2_TOXGO ATP-binding cassette sub-family B member ... 33 7.0
tr|B4IVA5|B4IVA5_DROYA GE14890 OS=Drosophila yakuba GN=GE14890 P... 33 7.0

>tr|Q7RN75|Q7RN75_PLAYO Putative uncharacterized protein PY01947
OS=Plasmodium yoelii yoelii GN=PY01947 PE=4 SV=1
Length = 2095

Score = 34.3 bits (77), Expect = 3.1
Identities = 14/53 (26%), Positives = 33/53 (62%)
Frame = +3

Query: 21 VRDMRQERFIERGRCDSDDDNRAVRDMRRGELLKDVAVQVGGETKEISCEAGG 179
+++M + + +E +++++ + + ++ E +K+V V+ GGE KE+ E GG
Sbjct: 986 IKEMEKVKEVEE--VETNEETKEIERVKETEEVKEVEVEKGGEVKEVEVEKGG 1036


>tr|Q4FAB4|Q4FAB4_TOXGO ATP-binding cassette sub-family B member 5
OS=Toxoplasma gondii GN=ABC.B5 PE=3 SV=1
Length = 705

Score = 33.1 bits (74), Expect = 7.0
Identities = 25/72 (34%), Positives = 38/72 (52%), Gaps = 1/72 (1%)
Frame = +3

Query: 72 DDDNRAVRDMRRGELLKDVAVQVG-GETKEISCEAGGYYGQRVLGSLGLHDWISPINLIV 248
+DD+ A R RRGE+L DV+ + G GE I ++G G+ L L +H + P +
Sbjct: 368 EDDDSAGRRRRRGEVLADVSFRAGKGEIMAIVGQSGA--GKSTLAKL-MHRFYDPQEGAI 424

Query: 249 RLHKRSISYLNV 284
L+ R I L +
Sbjct: 425 LLNGRDIRTLRL 436


>tr|B6KHJ2|B6KHJ2_TOXGO ATP-binding cassette sub-family B member 5
OS=Toxoplasma gondii ME49 GN=TGME49_049820 PE=4 SV=1
Length = 705

Score = 33.1 bits (74), Expect = 7.0
Identities = 25/72 (34%), Positives = 38/72 (52%), Gaps = 1/72 (1%)
Frame = +3

Query: 72 DDDNRAVRDMRRGELLKDVAVQVG-GETKEISCEAGGYYGQRVLGSLGLHDWISPINLIV 248
+DD+ A R RRGE+L DV+ + G GE I ++G G+ L L +H + P +
Sbjct: 368 EDDDSAGRRRRRGEVLADVSFRAGKGEIMAIVGQSGA--GKSTLAKL-MHRFYDPQEGAI 424

Query: 249 RLHKRSISYLNV 284
L+ R I L +
Sbjct: 425 LLNGRDIRTLRL 436


>tr|B4IVA5|B4IVA5_DROYA GE14890 OS=Drosophila yakuba GN=GE14890 PE=4
SV=1
Length = 424

Score = 33.1 bits (74), Expect = 7.0
Identities = 22/81 (27%), Positives = 35/81 (43%), Gaps = 4/81 (4%)
Frame = +3

Query: 69 SDDDNRAVRDMRRGELLKDVAVQVGGET----KEISCEAGGYYGQRVLGSLGLHDWISPI 236
SDD + ++R LL D + VGG+ + I C Y+ R L L L +
Sbjct: 143 SDDALNTLNELREENLLCDAQISVGGDVFNVHRAIMCSCSSYFRFRFLEDLHLKARNYTL 202

Query: 237 NLIVRLHKRSISYLNVSHRDW 299
+ R+I L++S D+
Sbjct: 203 RYFTEVANRNIDILDMSVDDF 223