BP917610
Clone id YMU001_000103_B01
Library
Length 515
Definition Adiantum capillus-veneris mRNA. clone: YMU001_000103_B01.
Accession
Tissue type prothallium
Developmental stage -
Contig ID -
Sequence
GGTTCCCGTCCCACTGTGGGGATTAGATTCTATGTACACTGAGGTGTACACTTTCAGCTT
GTACTGTTGACTCCACCATCCGCTACAAAGTATCTTGCGGATGCATTTAAAAAAAATTCG
GACAAAAGTCCTTCGTTAAACTTCTTTATCGTGTCTTCCTCAGAGAGGTTCAAGAATGGA
GCCACCTTGGAAAGAGTGAACAAATACTCATTCACATAATCCATGACTCGCTCGTGCTCC
TATCGGGCAAACCGATCCCAATTTTCTTTGATGCCTTCCTCAAAGCGTAGAGGAAAAAAA
TTTGTCCAAAAATTCAGCCTTGAATCGAATCTAAATCTTGTTGTGAATTCCTTGCAAAGC
TTTGGTATACCACCAAGTACTTGAAATTCCCTTGAGGTGTTTGGCCGCATGCCTCACCTT
CAATGCCTCTCAGAAATTACCGTTTGCAAAGGCAACTTCAATTTGTCGAATGAAAGCGGT
AGCTTTCGGGACATATTCTCTTCCGTCAAAAGTAT
■■Homology search results ■■ -
sp_hit_id Q66JG0
Definition sp|Q66JG0|OLA1_XENTR Obg-like ATPase 1 OS=Xenopus tropicalis
Align length 50
Score (bit) 34.7
E-value 0.27
Report
BLASTX 2.2.19 [Nov-02-2008]


Reference: Altschul, Stephen F., Thomas L. Madden, Alejandro A. Schaffer,
Jinghui Zhang, Zheng Zhang, Webb Miller, and David J. Lipman (1997),
"Gapped BLAST and PSI-BLAST: a new generation of protein database search
programs", Nucleic Acids Res. 25:3389-3402.

Query= BP917610|Adiantum capillus-veneris mRNA, clone:
YMU001_000103_B01.
(515 letters)

Database: uniprot_sprot.fasta
412,525 sequences; 148,809,765 total letters

Searching..................................................done



Score E
Sequences producing significant alignments: (bits) Value

sp|Q66JG0|OLA1_XENTR Obg-like ATPase 1 OS=Xenopus tropicalis GN=... 35 0.27
sp|Q7ZWM6|OLA1_XENLA Obg-like ATPase 1 OS=Xenopus laevis GN=ola1... 33 0.60
sp|Q5ZM25|OLA1_CHICK Obg-like ATPase 1 OS=Gallus gallus GN=OLA1 ... 31 3.0
sp|Q5R821|OLA1_PONAB Obg-like ATPase 1 OS=Pongo abelii GN=OLA1 P... 30 5.1
sp|Q9CZ30|OLA1_MOUSE Obg-like ATPase 1 OS=Mus musculus GN=Ola1 P... 30 5.1
sp|Q9NTK5|OLA1_HUMAN Obg-like ATPase 1 OS=Homo sapiens GN=OLA1 P... 30 5.1
sp|Q2HJ33|OLA1_BOVIN Obg-like ATPase 1 OS=Bos taurus GN=OLA1 PE=... 30 5.1
sp|P24839|VL2_HPV39 Minor capsid protein L2 OS=Human papillomavi... 30 6.7
sp|P25502|PUT3_YEAST Proline utilization trans-activator OS=Sacc... 30 8.7
sp|Q21353|EAA3_CAEEL Putative sodium-dependent excitatory amino ... 30 8.7
sp|P0C6F1|DYH2_MOUSE Dynein heavy chain 2, axonemal OS=Mus muscu... 30 8.7

>sp|Q66JG0|OLA1_XENTR Obg-like ATPase 1 OS=Xenopus tropicalis
GN=ola1 PE=2 SV=1
Length = 396

Score = 34.7 bits (78), Expect = 0.27
Identities = 20/50 (40%), Positives = 33/50 (66%), Gaps = 1/50 (2%)
Frame = -1

Query: 269 KENWDRFAR*EHERVMDYVNEYLFTLSKVAPFL-NLSEEDTIKKFNEGLL 123
++N RF +++ +D +N+YLF SK +L NLSE+D I+K N+ L+
Sbjct: 196 EKNHVRFYHDWNDKEIDVLNKYLFLTSKPMIYLVNLSEKDYIRKKNKWLI 245


>sp|Q7ZWM6|OLA1_XENLA Obg-like ATPase 1 OS=Xenopus laevis GN=ola1
PE=2 SV=1
Length = 396

Score = 33.5 bits (75), Expect = 0.60
Identities = 19/50 (38%), Positives = 33/50 (66%), Gaps = 1/50 (2%)
Frame = -1

Query: 269 KENWDRFAR*EHERVMDYVNEYLFTLSKVAPFL-NLSEEDTIKKFNEGLL 123
++N R+ +++ +D +N+YLF SK +L NLSE+D I+K N+ L+
Sbjct: 196 EKNHVRYYHDWNDKEIDVLNKYLFLTSKPMIYLINLSEKDYIRKKNKWLI 245


>sp|Q5ZM25|OLA1_CHICK Obg-like ATPase 1 OS=Gallus gallus GN=OLA1
PE=2 SV=1
Length = 396

Score = 31.2 bits (69), Expect = 3.0
Identities = 18/45 (40%), Positives = 30/45 (66%), Gaps = 1/45 (2%)
Frame = -1

Query: 254 RFAR*EHERVMDYVNEYLFTLSKVAPFL-NLSEEDTIKKFNEGLL 123
RF +++ +D +N++LF SK +L NLSE+D I+K N+ L+
Sbjct: 201 RFYHDWNDKEIDVLNKHLFFTSKPMIYLVNLSEKDYIRKKNKWLI 245


>sp|Q5R821|OLA1_PONAB Obg-like ATPase 1 OS=Pongo abelii GN=OLA1 PE=2
SV=1
Length = 396

Score = 30.4 bits (67), Expect = 5.1
Identities = 17/45 (37%), Positives = 30/45 (66%), Gaps = 1/45 (2%)
Frame = -1

Query: 254 RFAR*EHERVMDYVNEYLFTLSKVAPFL-NLSEEDTIKKFNEGLL 123
RF +++ ++ +N++LF SK +L NLSE+D I+K N+ L+
Sbjct: 201 RFYHDWNDKEIEVLNKHLFLTSKPMVYLVNLSEKDYIRKKNKWLI 245


>sp|Q9CZ30|OLA1_MOUSE Obg-like ATPase 1 OS=Mus musculus GN=Ola1 PE=1
SV=1
Length = 396

Score = 30.4 bits (67), Expect = 5.1
Identities = 17/45 (37%), Positives = 30/45 (66%), Gaps = 1/45 (2%)
Frame = -1

Query: 254 RFAR*EHERVMDYVNEYLFTLSKVAPFL-NLSEEDTIKKFNEGLL 123
RF +++ ++ +N++LF SK +L NLSE+D I+K N+ L+
Sbjct: 201 RFYHDWNDKEIEVLNKHLFLTSKPMVYLVNLSEKDYIRKKNKWLI 245


>sp|Q9NTK5|OLA1_HUMAN Obg-like ATPase 1 OS=Homo sapiens GN=OLA1 PE=1
SV=2
Length = 396

Score = 30.4 bits (67), Expect = 5.1
Identities = 17/45 (37%), Positives = 30/45 (66%), Gaps = 1/45 (2%)
Frame = -1

Query: 254 RFAR*EHERVMDYVNEYLFTLSKVAPFL-NLSEEDTIKKFNEGLL 123
RF +++ ++ +N++LF SK +L NLSE+D I+K N+ L+
Sbjct: 201 RFYHDWNDKEIEVLNKHLFLTSKPMVYLVNLSEKDYIRKKNKWLI 245


>sp|Q2HJ33|OLA1_BOVIN Obg-like ATPase 1 OS=Bos taurus GN=OLA1 PE=2
SV=1
Length = 396

Score = 30.4 bits (67), Expect = 5.1
Identities = 17/45 (37%), Positives = 30/45 (66%), Gaps = 1/45 (2%)
Frame = -1

Query: 254 RFAR*EHERVMDYVNEYLFTLSKVAPFL-NLSEEDTIKKFNEGLL 123
RF +++ ++ +N++LF SK +L NLSE+D I+K N+ L+
Sbjct: 201 RFYHDWNDKEIEVLNKHLFLTSKPMVYLVNLSEKDYIRKKNKWLI 245


>sp|P24839|VL2_HPV39 Minor capsid protein L2 OS=Human papillomavirus
type 39 GN=L2 PE=3 SV=1
Length = 470

Score = 30.0 bits (66), Expect = 6.7
Identities = 11/27 (40%), Positives = 18/27 (66%)
Frame = +3

Query: 186 LGKSEQILIHIIHDSLVLLSGKPIPIF 266
+G SE ++ ++ DS V+ SG P+P F
Sbjct: 96 VGPSEPSIVQLVEDSSVITSGTPVPTF 122


>sp|P25502|PUT3_YEAST Proline utilization trans-activator
OS=Saccharomyces cerevisiae GN=PUT3 PE=1 SV=1
Length = 979

Score = 29.6 bits (65), Expect = 8.7
Identities = 29/105 (27%), Positives = 43/105 (40%), Gaps = 8/105 (7%)
Frame = +1

Query: 130 PSLNFFIVSSSERFKNGATLERVNKYSFT*SMTRSCSYRAN----RSQFSLMPSSKRRGK 297
P L F +RFK T + YS T S +CS A+ RS +SL+ +S
Sbjct: 652 PLLFHFASIQLKRFKTSNTFVNLQNYSATISSLLTCSLHASVNTIRSLWSLLQNSMLAMF 711

Query: 298 KFVQKFXXXXXXXXXXXXXXXFGIPPST----*NSLEVFGRMPHL 420
++ + FGI T +SLE+F +M +L
Sbjct: 712 SYMDREYLFTSSCTLLLFNTAFGIHEQTLYHLDHSLEIFTQMRNL 756


>sp|Q21353|EAA3_CAEEL Putative sodium-dependent excitatory amino
acid transporter glt-3 OS=Caenorhabditis elegans
GN=glt-3 PE=1 SV=1
Length = 532

Score = 29.6 bits (65), Expect = 8.7
Identities = 18/46 (39%), Positives = 25/46 (54%)
Frame = +2

Query: 362 LVYHQVLEIPLRCLAACLTFNASQKLPFAKATSICRMKAVAFGTYS 499
L+ H +L +PL L F ++K PFA T + + A AFGT S
Sbjct: 270 LMIHSLLTLPL------LYFLVTKKSPFAFMTGMLQALATAFGTAS 309


tr_hit_id B8E2E3
Definition tr|B8E2E3|B8E2E3_9BACT MazG family protein OS=Dictyoglomus turgidum DSM 6724
Align length 106
Score (bit) 37.4
E-value 0.44
Report
BLASTX 2.2.19 [Nov-02-2008]


Reference: Altschul, Stephen F., Thomas L. Madden, Alejandro A. Schaffer,
Jinghui Zhang, Zheng Zhang, Webb Miller, and David J. Lipman (1997),
"Gapped BLAST and PSI-BLAST: a new generation of protein database search
programs", Nucleic Acids Res. 25:3389-3402.

Query= BP917610|Adiantum capillus-veneris mRNA, clone:
YMU001_000103_B01.
(515 letters)

Database: uniprot_trembl.fasta
7,341,751 sequences; 2,391,615,440 total letters

Searching..................................................done



Score E
Sequences producing significant alignments: (bits) Value

tr|B8E2E3|B8E2E3_9BACT MazG family protein OS=Dictyoglomus turgi... 37 0.44
tr|A5ALW7|A5ALW7_VITVI Putative uncharacterized protein OS=Vitis... 37 0.75
tr|Q949K8|Q949K8_CICAR Gag polyprotein (Fragment) OS=Cicer ariet... 36 1.3
tr|A9XZJ4|A9XZJ4_9BILA Putative GTP-binding protein (Fragment) O... 35 1.7
tr|Q0UP89|Q0UP89_PHANO Putative uncharacterized protein OS=Phaeo... 35 2.2
tr|B5YFB4|B5YFB4_DICT6 MazG OS=Dictyoglomus thermophilum (strain... 35 2.9
tr|B6Y1V0|B6Y1V0_ANATH Putative uncharacterized protein OS=Anaer... 34 4.9
tr|Q6SGR6|Q6SGR6_9BACT Phosphoadenosine phosphosulfate reductase... 33 8.3
tr|B7RW09|B7RW09_9GAMM Phosphoadenosine phosphosulfate reductase... 33 8.3

>tr|B8E2E3|B8E2E3_9BACT MazG family protein OS=Dictyoglomus turgidum
DSM 6724 GN=Dtur_1513 PE=4 SV=1
Length = 258

Score = 37.4 bits (85), Expect = 0.44
Identities = 27/106 (25%), Positives = 44/106 (41%), Gaps = 7/106 (6%)
Frame = -1

Query: 410 MRPNTSREFQVLGGIPKLCKEFTTRFRFDSRLNF----WTN---FFPLRFEEGIKENWDR 252
++ E +L GIPK T FR + + W N P +EE IKE
Sbjct: 122 IKSKEKEEKGILSGIPKNMPALLTAFRIQEKASHVGFDWKNSKEILPKLYEE-IKELEKA 180

Query: 251 FAR*EHERVMDYVNEYLFTLSKVAPFLNLSEEDTIKKFNEGLLSEF 114
E+V + + + LFT+ ++ L + E +++K N F
Sbjct: 181 IQEDNKEKVEEEIGDLLFTVVNISRHLGIDPESSLRKTNNKFTERF 226


>tr|A5ALW7|A5ALW7_VITVI Putative uncharacterized protein OS=Vitis
vinifera GN=VITISV_036166 PE=4 SV=1
Length = 873

Score = 36.6 bits (83), Expect = 0.75
Identities = 24/74 (32%), Positives = 35/74 (47%), Gaps = 2/74 (2%)
Frame = -1

Query: 335 FRFDSRLNFWTNFFPLRFEEGIK-ENWDRFAR*EHERVMDYVNEYLFT-LSKVAPFLNLS 162
F D + W F+ F + ++ + F R EHE + E FT LS+ AP L +
Sbjct: 114 FMLDKEADHWEAFYKKYFTDNVRRQKVGEFVRLEHENLTVTQYEAKFTELSRFAPLLIAT 173

Query: 161 EEDTIKKFNEGLLS 120
EE+ K +GL S
Sbjct: 174 EEEKTLKVQDGLKS 187


>tr|Q949K8|Q949K8_CICAR Gag polyprotein (Fragment) OS=Cicer
arietinum GN=gag PE=4 SV=1
Length = 277

Score = 35.8 bits (81), Expect = 1.3
Identities = 25/75 (33%), Positives = 37/75 (49%), Gaps = 3/75 (4%)
Frame = -3

Query: 510 FDGREYVPKATAFIRQIEVAFANGNF*EALKVRHAAKHLKGISSTWWYTKALQ--GIHNK 337
F G E KA +I+++E F N +KV +A L G + WW + L H +
Sbjct: 67 FKGDEGSEKADQWIQEVEKIFDMINCQAGVKVSYATYMLLGDAEYWWRSARLLMGAAHEE 126

Query: 336 I*IR-FKAEFLDKFF 295
+ FK +FLDK+F
Sbjct: 127 VNWESFKRKFLDKYF 141


>tr|A9XZJ4|A9XZJ4_9BILA Putative GTP-binding protein (Fragment)
OS=Thulinius stephaniae PE=2 SV=1
Length = 280

Score = 35.4 bits (80), Expect = 1.7
Identities = 22/39 (56%), Positives = 27/39 (69%), Gaps = 1/39 (2%)
Frame = -1

Query: 239 EHERVMDYVNEYLFTLSKVAPFL-NLSEEDTIKKFNEGL 126
EHE +D +N+YLF SK +L NLSEED IKK N+ L
Sbjct: 152 EHE--IDVLNKYLFLTSKPIIYLVNLSEEDYIKKKNKWL 188


>tr|Q0UP89|Q0UP89_PHANO Putative uncharacterized protein
OS=Phaeosphaeria nodorum GN=SNOG_06425 PE=4 SV=2
Length = 571

Score = 35.0 bits (79), Expect = 2.2
Identities = 25/65 (38%), Positives = 32/65 (49%), Gaps = 11/65 (16%)
Frame = -1

Query: 347 FTTRFRFDSRL---NFWTNFFPLRFEEGIK--------ENWDRFAR*EHERVMDYVNEYL 201
F +R+R R+ NFW N L++ + IK ENWD R EH+R DY N L
Sbjct: 346 FESRYRGRDRITNANFWHNQLTLQWYK-IKTANTAMPVENWDDTIRAEHDRYCDYENTKL 404

Query: 200 FTLSK 186
L K
Sbjct: 405 SQLQK 409


>tr|B5YFB4|B5YFB4_DICT6 MazG OS=Dictyoglomus thermophilum (strain
ATCC 35947 / DSM 3960 / H-6-12) GN=DICTH_1403 PE=4 SV=1
Length = 258

Score = 34.7 bits (78), Expect = 2.9
Identities = 24/96 (25%), Positives = 42/96 (43%), Gaps = 7/96 (7%)
Frame = -1

Query: 380 VLGGIPKLCKEFTTRFRFDSRLNF----WTN---FFPLRFEEGIKENWDRFAR*EHERVM 222
+L GIP+ T FR +++ W N P +EE +KE E +
Sbjct: 132 ILSGIPQNMPALLTAFRIQEKVSHVGFDWKNSKEIIPKLYEE-LKELEKAIQEDNKEDME 190

Query: 221 DYVNEYLFTLSKVAPFLNLSEEDTIKKFNEGLLSEF 114
+ + + LFT+ +A L + E +++K N+ F
Sbjct: 191 EEIGDLLFTIVNIARHLGIDPESSLRKTNKKFTERF 226


>tr|B6Y1V0|B6Y1V0_ANATH Putative uncharacterized protein
OS=Anaerocellum thermophilum DSM 6725 GN=AtheDRAFT_1451
PE=4 SV=1
Length = 444

Score = 33.9 bits (76), Expect = 4.9
Identities = 28/99 (28%), Positives = 45/99 (45%), Gaps = 4/99 (4%)
Frame = -1

Query: 395 SREF----QVLGGIPKLCKEFTTRFRFDSRLNFWTNFFPLRFEEGIKENWDRFAR*EHER 228
+REF ++L + KE R + N + +++ E + N+D F + R
Sbjct: 350 TREFSECKKLLENFERFLKEAKNRLKVSLSSNLFDSYYKNLKELFYECNFDEFKK----R 405

Query: 227 VMDYVNEYLFTLSKVAPFLNLSEEDTIKKFNEGLLSEFF 111
++Y N+ L K F + S DTIKK + L EFF
Sbjct: 406 YIEYQNDISDALLKSTSF-STSSSDTIKKVIKDLFDEFF 443


>tr|Q6SGR6|Q6SGR6_9BACT Phosphoadenosine phosphosulfate reductase
OS=uncultured marine bacterium 463 GN=cysH PE=4 SV=1
Length = 208

Score = 33.1 bits (74), Expect = 8.3
Identities = 24/87 (27%), Positives = 41/87 (47%), Gaps = 5/87 (5%)
Frame = -1

Query: 398 TSREFQVLGGIPKLCKE-----FTTRFRFDSRLNFWTNFFPLRFEEGIKENWDRFAR*EH 234
+ R ++GG+P + +E FT + + + T F P + GI+E EH
Sbjct: 93 SERRNAIMGGVPTVDEEERHQDFTEQVKLEPFARALTQFRPEIWLTGIREEET-----EH 147

Query: 233 ERVMDYVNEYLFTLSKVAPFLNLSEED 153
+ +D V+ + KVAP N S++D
Sbjct: 148 RKSLDIVSMDNRGIVKVAPIFNWSDDD 174


>tr|B7RW09|B7RW09_9GAMM Phosphoadenosine phosphosulfate reductase
family, putative OS=marine gamma proteobacterium
HTCC2148 GN=GPB2148_2304 PE=4 SV=1
Length = 208

Score = 33.1 bits (74), Expect = 8.3
Identities = 24/87 (27%), Positives = 41/87 (47%), Gaps = 5/87 (5%)
Frame = -1

Query: 398 TSREFQVLGGIPKLCKE-----FTTRFRFDSRLNFWTNFFPLRFEEGIKENWDRFAR*EH 234
+ R ++GG+P + +E FT + + + T F P + GI+E EH
Sbjct: 93 SERRNAIMGGVPTVDEEERHQDFTEQVKLEPFARALTQFRPEIWLTGIREEET-----EH 147

Query: 233 ERVMDYVNEYLFTLSKVAPFLNLSEED 153
+ +D V+ + KVAP N S++D
Sbjct: 148 RKSLDIVSMDNRGIVKVAPIFNWSDDD 174