BP917624
Clone id YMU001_000103_C12
Library
Length 259
Definition Adiantum capillus-veneris mRNA. clone: YMU001_000103_C12.
Accession
Tissue type prothallium
Developmental stage -
Contig ID -
Sequence
TCAAATCTTGGAACTCAAACTTAGTGGTGTGAGTGGCTTTAAGCTACATAAGTAGAAGCA
GTTTCTTGAGTGTTCAGTAGGTGTTATCTTGGACAAATTGGAGGGTCTTTGGGTTGGCCA
AGATGAAGTGTTTGGTATCCCTTCACATGTATATAGATTGCATATTGCAGTTAGTAAGAT
CGATATGATTCTAGGGAGCTTATTTAGGATTCCAATATCAAAGGCTTGCCTTCATGTTTG
AGTGGCTGATAGTCAATTC
■■Homology search results ■■ -
sp_hit_id Q05AX3
Definition sp|Q05AX3|PSMG1_XENLA Proteasome assembly chaperone 1 OS=Xenopus laevis
Align length 56
Score (bit) 30.8
E-value 2.2
Report
BLASTX 2.2.19 [Nov-02-2008]


Reference: Altschul, Stephen F., Thomas L. Madden, Alejandro A. Schaffer,
Jinghui Zhang, Zheng Zhang, Webb Miller, and David J. Lipman (1997),
"Gapped BLAST and PSI-BLAST: a new generation of protein database search
programs", Nucleic Acids Res. 25:3389-3402.

Query= BP917624|Adiantum capillus-veneris mRNA, clone:
YMU001_000103_C12.
(259 letters)

Database: uniprot_sprot.fasta
412,525 sequences; 148,809,765 total letters

Searching..................................................done



Score E
Sequences producing significant alignments: (bits) Value

sp|Q05AX3|PSMG1_XENLA Proteasome assembly chaperone 1 OS=Xenopus... 31 2.2
sp|P40333|MAB11_COPCI Mating-type protein beta1-1 OS=Coprinopsis... 30 4.8
sp|Q96EW2|HBAP1_HUMAN HSPB1-associated protein 1 OS=Homo sapiens... 29 8.2

>sp|Q05AX3|PSMG1_XENLA Proteasome assembly chaperone 1 OS=Xenopus
laevis GN=psmg1 PE=2 SV=1
Length = 288

Score = 30.8 bits (68), Expect = 2.2
Identities = 18/56 (32%), Positives = 28/56 (50%)
Frame = +2

Query: 86 ILDKLEGLWVGQDEVFGIPSHVYRLHIAVSKIDMILGSLFRIPISKACLHV*VADS 253
I+D L + +V GIP+ Y+ + +SK+D + FR +S L ADS
Sbjct: 211 IVDGLPAAVLSHCQVLGIPAVFYQCYTDISKLDSVTIKAFRPLLSSGSLSRLAADS 266


>sp|P40333|MAB11_COPCI Mating-type protein beta1-1 OS=Coprinopsis
cinerea PE=3 SV=1
Length = 681

Score = 29.6 bits (65), Expect = 4.8
Identities = 20/60 (33%), Positives = 31/60 (51%), Gaps = 11/60 (18%)
Frame = -2

Query: 207 LNKLPRIISILLTAICNLYTCEGIPN-----------TSSWPTQRPSNLSKITPTEHSRN 61
L K PR S+ C L +G+P+ TS+ P+ +PS L K+TPT+ +R+
Sbjct: 380 LCKRPRSQSVF----CELSPVKGLPSPSPSTQDELLETSAAPSPQPSLLPKLTPTDSARS 435


>sp|Q96EW2|HBAP1_HUMAN HSPB1-associated protein 1 OS=Homo sapiens
GN=HSPBAP1 PE=1 SV=1
Length = 488

Score = 28.9 bits (63), Expect = 8.2
Identities = 14/39 (35%), Positives = 20/39 (51%)
Frame = -2

Query: 165 ICNLYTCEGIPNTSSWPTQRPSNLSKITPTEHSRNCFYL 49
+C L T E NT +W N +++ T H+ NC YL
Sbjct: 292 VCALKTAENPQNTRAW-----LNPTEVEETSHAVNCCYL 325


tr_hit_id -
Definition No hits.
Align length -
Score (bit) -
E-value -
Report
BLASTX 2.2.19 [Nov-02-2008]


Reference: Altschul, Stephen F., Thomas L. Madden, Alejandro A. Schaffer,
Jinghui Zhang, Zheng Zhang, Webb Miller, and David J. Lipman (1997),
"Gapped BLAST and PSI-BLAST: a new generation of protein database search
programs", Nucleic Acids Res. 25:3389-3402.

Query= BP917624|Adiantum capillus-veneris mRNA, clone:
YMU001_000103_C12.
(259 letters)

Database: uniprot_trembl.fasta
7,341,751 sequences; 2,391,615,440 total letters

Searching..................................................done

***** No hits found ******