BP917648
Clone id YMU001_000103_F11
Library
Length 527
Definition Adiantum capillus-veneris mRNA. clone: YMU001_000103_F11.
Accession
Tissue type prothallium
Developmental stage -
Contig ID -
Sequence
TGCACTTGAAATTTGACATGCAGGTGCAAGATTTAAGCCCATGCTAGCCAGCTACACCTC
CACATTTGTCACAAACAGTCTTCACCCATAAACTCTTGAGGCCACAGTTAGCTCATGATT
GACTCAAACTATATATGCAGCATACAAAGCTTCATACATGCTCAACAGCACACGATGATC
ATCCACCATGCTGAAAAGATGGCAATCCGAAACAAAATAAAAAGGTAAGTTTCAACCACA
ATATCTTGTAATTACGCCAACATAAAACAGCCACAGATTGCACTTCTTCCTACTGGGAGG
ATTATACAAATATCAGATTCTGTACACACTCCACAAATTCTGGATATCACCTCGTCAGAC
CGCAGAGGCATTCCAGGCGTCCACATGATCTGGACTACCACCTCCTTAGGTGGCAACAAA
GGGACCACATTCTCATGCCCCAAGCTCAAGATCAATTCCATCAGAACAGTTTGCTCATCA
ATCCTTCTAACCACTTATCTCCCTCGCTGAAATTCAACTCTACTCCT
■■Homology search results ■■ -
sp_hit_id Q8IZX4
Definition sp|Q8IZX4|TAF1L_HUMAN Transcription initiation factor TFIID 210 kDa subunit OS=Homo sapiens
Align length 81
Score (bit) 34.7
E-value 0.29
Report
BLASTX 2.2.19 [Nov-02-2008]


Reference: Altschul, Stephen F., Thomas L. Madden, Alejandro A. Schaffer,
Jinghui Zhang, Zheng Zhang, Webb Miller, and David J. Lipman (1997),
"Gapped BLAST and PSI-BLAST: a new generation of protein database search
programs", Nucleic Acids Res. 25:3389-3402.

Query= BP917648|Adiantum capillus-veneris mRNA, clone:
YMU001_000103_F11.
(527 letters)

Database: uniprot_sprot.fasta
412,525 sequences; 148,809,765 total letters

Searching..................................................done



Score E
Sequences producing significant alignments: (bits) Value

sp|Q8IZX4|TAF1L_HUMAN Transcription initiation factor TFIID 210 ... 35 0.29
sp|P62285|ASPM_BOVIN Abnormal spindle-like microcephaly-associat... 28 1.7
sp|Q8WTR7|ZN473_HUMAN Zinc finger protein 473 OS=Homo sapiens GN... 32 2.4
sp|Q8WXI9|P66B_HUMAN Transcriptional repressor p66-beta OS=Homo ... 32 2.4
sp|P50346|RLA0_SOYBN 60S acidic ribosomal protein P0 OS=Glycine ... 31 3.2
sp|Q9N4G4|MED1_CAEEL Mediator of RNA polymerase II transcription... 31 3.2
sp|Q9UBI9|HDC_HUMAN Headcase protein homolog OS=Homo sapiens GN=... 31 3.2
sp|B1ZPB7|RPOC_OPITP DNA-directed RNA polymerase subunit beta' O... 31 4.1
sp|P21687|CRTY_PANAN Lycopene cyclase OS=Pantoea ananas GN=crtY ... 31 4.1
sp|Q8BZ34|ZN641_MOUSE Zinc finger protein 641 OS=Mus musculus GN... 30 7.1
sp|Q05892|YL290_YEAST Uncharacterized protein YLR290C, mitochond... 30 7.1
sp|P62286|ASPM_CANFA Abnormal spindle-like microcephaly-associat... 27 7.5

>sp|Q8IZX4|TAF1L_HUMAN Transcription initiation factor TFIID 210 kDa
subunit OS=Homo sapiens GN=TAF1L PE=1 SV=1
Length = 1826

Score = 34.7 bits (78), Expect = 0.29
Identities = 22/81 (27%), Positives = 35/81 (43%)
Frame = +1

Query: 154 IHAQQHTMIIHHAEKMAIRNKIKR*VSTTISCNYANIKQPQIALLPTGRIIQISDSVHTP 333
+H + ++ K + K KR V TT+ C+Y NI I T ++ +S
Sbjct: 1352 VHEVRRKSLVLKFPKQQLPPKKKRRVGTTVHCDYLNIPHKSIHRRRTDPMVTLS------ 1405

Query: 334 QILDITSSDRRGIPGVHMIWT 396
IL+ +D R +P H T
Sbjct: 1406 SILESIINDMRDLPNTHPFHT 1426


>sp|P62285|ASPM_BOVIN Abnormal spindle-like microcephaly-associated
protein homolog (Fragment) OS=Bos taurus GN=ASPM PE=2
SV=1
Length = 3371

Score = 28.1 bits (61), Expect(2) = 1.7
Identities = 13/43 (30%), Positives = 24/43 (55%)
Frame = +2

Query: 125 QTIYAAYKASYMLNSTR*SSTMLKRWQSETK*KGKFQPQYLVI 253
Q+ Y AY+A S R ++ +++RW K G+ + +YL +
Sbjct: 1967 QSRYRAYQARKKYASYRAAAVIIQRWYRAAKLAGRQREEYLAV 2009



Score = 22.3 bits (46), Expect(2) = 1.7
Identities = 10/30 (33%), Positives = 15/30 (50%)
Frame = +3

Query: 297 EDYTNIRFCTHSTNSGYHLVRPQRHSRRPH 386
E+Y ++ + Y VR +RH RR H
Sbjct: 2004 EEYLAVKKAALKIQAVYRGVRARRHIRRMH 2033


>sp|Q8WTR7|ZN473_HUMAN Zinc finger protein 473 OS=Homo sapiens
GN=ZNF473 PE=1 SV=1
Length = 871

Score = 31.6 bits (70), Expect = 2.4
Identities = 29/109 (26%), Positives = 45/109 (41%), Gaps = 5/109 (4%)
Frame = +3

Query: 132 YMQHTKLHT----CSTAHDDHPPC*KDGNPKQNKKVSFNHNIL*LRQHKTATDCTSSYWE 299
Y+ H K HT C + DHPP D P +++ KT TD + SY
Sbjct: 279 YLWHQKTHTGEKPCKSQDSDHPPS-HDTQPGEHQ--------------KTHTD-SKSY-- 320

Query: 300 DYTNIRFCTHSTNSGYHLVRPQR-HSRRPHDLDYHLLRWQQRDHILMPQ 443
N C + +HL R Q+ H+R+ ++ + R H++ Q
Sbjct: 321 ---NCNECGKAFTRIFHLTRHQKIHTRKRYECSKCQATFNLRKHLIQHQ 366


>sp|Q8WXI9|P66B_HUMAN Transcriptional repressor p66-beta OS=Homo
sapiens GN=GATAD2B PE=1 SV=1
Length = 593

Score = 31.6 bits (70), Expect = 2.4
Identities = 18/59 (30%), Positives = 31/59 (52%), Gaps = 3/59 (5%)
Frame = +1

Query: 268 QPQIAL---LPTGRIIQISDSVHTPQILDITSSDRRGIPGVHMIWTTTSLGGNKGTTFS 435
QPQ +L +PT +S+ PQ+ G+PGV++ + T +GG+KG + +
Sbjct: 513 QPQSSLQRGIPTSARSMLSNFAQAPQLS--VPGGLLGMPGVNIAYLNTGIGGHKGPSLA 569


>sp|P50346|RLA0_SOYBN 60S acidic ribosomal protein P0 OS=Glycine max
PE=2 SV=1
Length = 320

Score = 31.2 bits (69), Expect = 3.2
Identities = 20/62 (32%), Positives = 34/62 (54%), Gaps = 2/62 (3%)
Frame = +1

Query: 319 SVHTPQILDITSSDRRG--IPGVHMIWTTTSLGGNKGTTFSCPKLKINSIRTVCSSILLT 492
SV +P++LD+T D G GV M+ T+ SL + T + P + +N+ + V + + T
Sbjct: 200 SVFSPEVLDLTEDDLIGKFAAGVSMV-TSLSLAISYPTLAAAPHMFVNAYKNVLAVAVET 258

Query: 493 TY 498
Y
Sbjct: 259 DY 260


>sp|Q9N4G4|MED1_CAEEL Mediator of RNA polymerase II transcription
subunit 1.1 OS=Caenorhabditis elegans GN=sop-3 PE=2 SV=2
Length = 1475

Score = 31.2 bits (69), Expect = 3.2
Identities = 15/49 (30%), Positives = 25/49 (51%), Gaps = 1/49 (2%)
Frame = +3

Query: 363 QRHSRRPHDLD-YHLLRWQQRDHILMPQAQDQFHQNSLLINPSNHLSPS 506
++H+ PH + Y + ++QQ M Q Q Q Q + +P N L P+
Sbjct: 760 EQHNPNPHQMSQYQMQQYQQNQQFRMHQMQQQQQQQFQMQSPKNPLVPA 808


>sp|Q9UBI9|HDC_HUMAN Headcase protein homolog OS=Homo sapiens
GN=HECA PE=1 SV=1
Length = 543

Score = 31.2 bits (69), Expect = 3.2
Identities = 10/24 (41%), Positives = 16/24 (66%)
Frame = +3

Query: 291 YWEDYTNIRFCTHSTNSGYHLVRP 362
Y+ +Y+N++ C H N YH V+P
Sbjct: 510 YFSEYSNVQQCPHCGNLDYHFVKP 533


>sp|B1ZPB7|RPOC_OPITP DNA-directed RNA polymerase subunit beta'
OS=Opitutus terrae (strain DSM 11246 / PB90-1) GN=rpoC
PE=3 SV=1
Length = 1384

Score = 30.8 bits (68), Expect = 4.1
Identities = 17/60 (28%), Positives = 29/60 (48%)
Frame = +1

Query: 292 TGRIIQISDSVHTPQILDITSSDRRGIPGVHMIWTTTSLGGNKGTTFSCPKLKINSIRTV 471
TG++ ++ DSV I ++ G PG + T +GG F P++K+ + TV
Sbjct: 909 TGKVAKVGDSV------GIIAAQSIGEPGTQLTMRTFHIGGVASGGFKTPEIKVRASGTV 962


>sp|P21687|CRTY_PANAN Lycopene cyclase OS=Pantoea ananas GN=crtY
PE=4 SV=1
Length = 382

Score = 30.8 bits (68), Expect = 4.1
Identities = 19/53 (35%), Positives = 25/53 (47%), Gaps = 2/53 (3%)
Frame = +3

Query: 216 NKKVSFNHNIL*LRQHKTATDCTSSYWEDYTNIRFCT--HSTNSGYHLVRPQR 368
N SF+H+ L QH+ +W DY +RF T NSGY + QR
Sbjct: 44 NHTWSFHHDDLTESQHRWIAPLVVHHWPDY-QVRFPTRRRKLNSGYFCITSQR 95


>sp|Q8BZ34|ZN641_MOUSE Zinc finger protein 641 OS=Mus musculus
GN=Znf641 PE=2 SV=1
Length = 422

Score = 30.0 bits (66), Expect = 7.1
Identities = 16/49 (32%), Positives = 25/49 (51%), Gaps = 1/49 (2%)
Frame = +3

Query: 273 TDCTSSYWEDYTNIR-FCTHSTNSGYHLVRPQRHSRRPHDLDYHLLRWQ 416
T+C S+ + +R + TH+ +H R ++ R H LD HLL Q
Sbjct: 359 TECGKSFGRRHHLVRHWLTHTGEKPFHCPRCEKSFGRKHHLDRHLLTHQ 407


tr_hit_id Q8E376
Definition tr|Q8E376|Q8E376_STRA3 Putative uncharacterized protein gbs1885 OS=Streptococcus agalactiae serotype III
Align length 89
Score (bit) 34.3
E-value 4.0
Report
BLASTX 2.2.19 [Nov-02-2008]


Reference: Altschul, Stephen F., Thomas L. Madden, Alejandro A. Schaffer,
Jinghui Zhang, Zheng Zhang, Webb Miller, and David J. Lipman (1997),
"Gapped BLAST and PSI-BLAST: a new generation of protein database search
programs", Nucleic Acids Res. 25:3389-3402.

Query= BP917648|Adiantum capillus-veneris mRNA, clone:
YMU001_000103_F11.
(527 letters)

Database: uniprot_trembl.fasta
7,341,751 sequences; 2,391,615,440 total letters

Searching..................................................done



Score E
Sequences producing significant alignments: (bits) Value

tr|Q8E376|Q8E376_STRA3 Putative uncharacterized protein gbs1885 ... 34 4.0
tr|Q8DXF4|Q8DXF4_STRA5 Putative uncharacterized protein OS=Strep... 34 4.0
tr|Q3DUP6|Q3DUP6_STRAG Putative uncharacterized protein OS=Strep... 34 4.0
tr|Q3DKB2|Q3DKB2_STRAG Putative uncharacterized protein OS=Strep... 34 4.0
tr|B8GSF1|B8GSF1_9GAMM Putative uncharacterized protein OS=Thioa... 33 6.7
tr|B8BSM4|B8BSM4_THAPS Predicted protein OS=Thalassiosira pseudo... 33 8.8
tr|B4M8D8|B4M8D8_DROVI GJ16791 OS=Drosophila virilis GN=GJ16791 ... 33 8.8
tr|A2DU98|A2DU98_TRIVA Surface antigen BspA-like OS=Trichomonas ... 33 8.8

>tr|Q8E376|Q8E376_STRA3 Putative uncharacterized protein gbs1885
OS=Streptococcus agalactiae serotype III GN=gbs1885 PE=4
SV=1
Length = 634

Score = 34.3 bits (77), Expect = 4.0
Identities = 25/89 (28%), Positives = 35/89 (39%)
Frame = +3

Query: 180 HPPC*KDGNPKQNKKVSFNHNIL*LRQHKTATDCTSSYWEDYTNIRFCTHSTNSGYHLVR 359
H C DG P + K S+ +N Y +C ++ YHLV
Sbjct: 412 HSTCTLDGQPLEMIKDSWTYN-------------------SYPKCDYCQLTSKDRYHLVE 452

Query: 360 PQRHSRRPHDLDYHLLRWQQRDHILMPQA 446
Q H +R D+ YH RW + +PQA
Sbjct: 453 GQLHVQRASDIYYH-KRWL----LTLPQA 476


>tr|Q8DXF4|Q8DXF4_STRA5 Putative uncharacterized protein
OS=Streptococcus agalactiae serotype V GN=SAG1897 PE=4
SV=1
Length = 634

Score = 34.3 bits (77), Expect = 4.0
Identities = 25/89 (28%), Positives = 35/89 (39%)
Frame = +3

Query: 180 HPPC*KDGNPKQNKKVSFNHNIL*LRQHKTATDCTSSYWEDYTNIRFCTHSTNSGYHLVR 359
H C DG P + K S+ +N Y +C ++ YHLV
Sbjct: 412 HSTCTLDGQPLEMIKDSWTYN-------------------SYPKCDYCQLTSKDRYHLVE 452

Query: 360 PQRHSRRPHDLDYHLLRWQQRDHILMPQA 446
Q H +R D+ YH RW + +PQA
Sbjct: 453 GQLHVQRASDIYYH-KRWL----LTLPQA 476


>tr|Q3DUP6|Q3DUP6_STRAG Putative uncharacterized protein
OS=Streptococcus agalactiae 18RS21 GN=SAJ_1804 PE=4 SV=1
Length = 634

Score = 34.3 bits (77), Expect = 4.0
Identities = 25/89 (28%), Positives = 35/89 (39%)
Frame = +3

Query: 180 HPPC*KDGNPKQNKKVSFNHNIL*LRQHKTATDCTSSYWEDYTNIRFCTHSTNSGYHLVR 359
H C DG P + K S+ +N Y +C ++ YHLV
Sbjct: 412 HSTCTLDGQPLEMIKDSWTYN-------------------SYPKCDYCQLTSKDRYHLVE 452

Query: 360 PQRHSRRPHDLDYHLLRWQQRDHILMPQA 446
Q H +R D+ YH RW + +PQA
Sbjct: 453 GQLHVQRASDIYYH-KRWL----LTLPQA 476


>tr|Q3DKB2|Q3DKB2_STRAG Putative uncharacterized protein
OS=Streptococcus agalactiae 515 GN=SAL_1940 PE=4 SV=1
Length = 634

Score = 34.3 bits (77), Expect = 4.0
Identities = 25/89 (28%), Positives = 35/89 (39%)
Frame = +3

Query: 180 HPPC*KDGNPKQNKKVSFNHNIL*LRQHKTATDCTSSYWEDYTNIRFCTHSTNSGYHLVR 359
H C DG P + K S+ +N Y +C ++ YHLV
Sbjct: 412 HSTCTLDGQPLEMIKDSWTYN-------------------SYPKCDYCQLTSKDRYHLVE 452

Query: 360 PQRHSRRPHDLDYHLLRWQQRDHILMPQA 446
Q H +R D+ YH RW + +PQA
Sbjct: 453 GQLHVQRASDIYYH-KRWL----LTLPQA 476


>tr|B8GSF1|B8GSF1_9GAMM Putative uncharacterized protein
OS=Thioalkalivibrio sp. HL-EbGR7 GN=Tgr7_1773 PE=4 SV=1
Length = 1575

Score = 33.5 bits (75), Expect = 6.7
Identities = 17/36 (47%), Positives = 23/36 (63%), Gaps = 2/36 (5%)
Frame = +3

Query: 402 LLRW--QQRDHILMPQAQDQFHQNSLLINPSNHLSP 503
+LRW + R H L+ + DQF+QN LLI PS +P
Sbjct: 1017 MLRWHYRSRHHSLIAVSNDQFYQNQLLIFPSPGSNP 1052


>tr|B8BSM4|B8BSM4_THAPS Predicted protein OS=Thalassiosira
pseudonana CCMP1335 GN=THAPSDRAFT_2034 PE=4 SV=1
Length = 712

Score = 33.1 bits (74), Expect = 8.8
Identities = 19/53 (35%), Positives = 25/53 (47%), Gaps = 1/53 (1%)
Frame = +3

Query: 294 WEDYTNIRFCTHSTNSGYHLVRPQRHSRRPHDL-DYHLLRWQQRDHILMPQAQ 449
W Y T S NS + + Q + R+ H L DY LLR+ DH MP +
Sbjct: 255 WVYYIGDEDPTDSLNSEFETIGLQLYHRKKHQLLDYDLLRFASIDHDTMPSVE 307


>tr|B4M8D8|B4M8D8_DROVI GJ16791 OS=Drosophila virilis GN=GJ16791
PE=4 SV=1
Length = 889

Score = 33.1 bits (74), Expect = 8.8
Identities = 17/65 (26%), Positives = 28/65 (43%)
Frame = +3

Query: 327 HSTNSGYHLVRPQRHSRRPHDLDYHLLRWQQRDHILMPQAQDQFHQNSLLINPSNHLSPS 506
H + +H+ R Q+ ++ HL + QQ+ L Q Q Q HQ + H P+
Sbjct: 672 HQHHHIHHVQRQQQQQQQQQHQHQHLQQQQQQQQHLQQQQQQQQHQQHQHLQQQQHQRPA 731

Query: 507 LKFNS 521
L +
Sbjct: 732 LSLQA 736


>tr|A2DU98|A2DU98_TRIVA Surface antigen BspA-like OS=Trichomonas
vaginalis G3 GN=TVAG_278570 PE=4 SV=1
Length = 469

Score = 33.1 bits (74), Expect = 8.8
Identities = 25/87 (28%), Positives = 42/87 (48%), Gaps = 7/87 (8%)
Frame = +1

Query: 232 STTISCNYAN-----IKQPQIALLPTGRIIQISDSVHTPQILDITSSDRRGIPGVHMIWT 396
S T++ + N +K ++ LPTG + D V QILD+T S IP ++ +
Sbjct: 45 SATLAQQFLNGGCTTLKIDSLSALPTGTSKTVFDYV---QILDLTGSQITNIPEIYFLSN 101

Query: 397 TT--SLGGNKGTTFSCPKLKINSIRTV 471
+ GT+ S K++SI+T+
Sbjct: 102 NVIQEVKLKTGTSISALAFKLSSIKTI 128