BP917698
Clone id YMU001_000104_C12
Library
Length 483
Definition Adiantum capillus-veneris mRNA. clone: YMU001_000104_C12.
Accession
Tissue type prothallium
Developmental stage -
Contig ID -
Sequence
AGGATGCAACAATTCAAGCATGTCAAGAACTGCTAAGTTCGGATCACCCAAACTATGAAA
GGAACAAACGGATTCTGGCAATCTTCAGGTATTACTTTCTCACTAGAGAAGCCAAAGAAG
ATAAAGAAAAAGGTGATCTTCCCACTATCTTCTCTCACTACGATGGCCTTGCGATGGCCT
CTACTATTTGATCCACACCATACCCTGTGGATTCCACCAGATTCTCTTTACCTCTTTACA
GTTTCGGGCTAAACAATTTCGGGCCCAAGTGCGATCTGTGCAGTTAAGCTTTAAATGTTA
TGCTGCACCTCTCTTAGCATGGGTCATAAATATATATGTTGCCTCGACGAAGTGGATGAG
GATCCATACGGAACCTCGAAAGGGAAAAGAAAATCTGTAAGTATTCAGGTTGACCCTACA
GTTACCAAGAAAAAAGAAGATCAACGCGAAAGTGGCGAATGATACAGTGCAGTCTTTACT
CTC
■■Homology search results ■■ -
sp_hit_id Q9DAC9
Definition sp|Q9DAC9|PO5F2_MOUSE POU domain, class 5, transcription factor 2 OS=Mus musculus
Align length 34
Score (bit) 30.4
E-value 4.4
Report
BLASTX 2.2.19 [Nov-02-2008]


Reference: Altschul, Stephen F., Thomas L. Madden, Alejandro A. Schaffer,
Jinghui Zhang, Zheng Zhang, Webb Miller, and David J. Lipman (1997),
"Gapped BLAST and PSI-BLAST: a new generation of protein database search
programs", Nucleic Acids Res. 25:3389-3402.

Query= BP917698|Adiantum capillus-veneris mRNA, clone:
YMU001_000104_C12.
(483 letters)

Database: uniprot_sprot.fasta
412,525 sequences; 148,809,765 total letters

Searching..................................................done



Score E
Sequences producing significant alignments: (bits) Value

sp|Q9DAC9|PO5F2_MOUSE POU domain, class 5, transcription factor ... 30 4.4
sp|Q14687|GSE1_HUMAN Genetic suppressor element 1 OS=Homo sapien... 30 5.7

>sp|Q9DAC9|PO5F2_MOUSE POU domain, class 5, transcription factor 2
OS=Mus musculus GN=Pou5f2 PE=2 SV=1
Length = 329

Score = 30.4 bits (67), Expect = 4.4
Identities = 13/34 (38%), Positives = 18/34 (52%)
Frame = +3

Query: 150 FSHYDGLAMASTI*STPYPVDSTRFSLPLYSFGL 251
F+HY+G + STP+PV S P + GL
Sbjct: 291 FTHYEGSCLTPLYSSTPFPVRGALLSAPTTTLGL 324


>sp|Q14687|GSE1_HUMAN Genetic suppressor element 1 OS=Homo sapiens
GN=GSE1 PE=1 SV=3
Length = 1217

Score = 30.0 bits (66), Expect = 5.7
Identities = 11/31 (35%), Positives = 20/31 (64%)
Frame = +3

Query: 39 SDHPNYERNKRILAIFRYYFLTREAKEDKEK 131
++ PN+E K+ L IF ++ E ++DKE+
Sbjct: 855 NNSPNFEEKKKFLTIFNLTHISAEKRKDKER 885


tr_hit_id B7G3T5
Definition tr|B7G3T5|B7G3T5_PHATR Predicted protein OS=Phaeodactylum tricornutum CCAP 1055/1
Align length 62
Score (bit) 37.7
E-value 0.28
Report
BLASTX 2.2.19 [Nov-02-2008]


Reference: Altschul, Stephen F., Thomas L. Madden, Alejandro A. Schaffer,
Jinghui Zhang, Zheng Zhang, Webb Miller, and David J. Lipman (1997),
"Gapped BLAST and PSI-BLAST: a new generation of protein database search
programs", Nucleic Acids Res. 25:3389-3402.

Query= BP917698|Adiantum capillus-veneris mRNA, clone:
YMU001_000104_C12.
(483 letters)

Database: uniprot_trembl.fasta
7,341,751 sequences; 2,391,615,440 total letters

Searching..................................................done



Score E
Sequences producing significant alignments: (bits) Value

tr|B7G3T5|B7G3T5_PHATR Predicted protein OS=Phaeodactylum tricor... 38 0.28

>tr|B7G3T5|B7G3T5_PHATR Predicted protein OS=Phaeodactylum
tricornutum CCAP 1055/1 GN=APC2 PE=4 SV=1
Length = 767

Score = 37.7 bits (86), Expect = 0.28
Identities = 19/62 (30%), Positives = 35/62 (56%)
Frame = +2

Query: 179 LYYLIHTIPCGFHQILFTSLQFRAKQFRAQVRSVQLSFKCYAAPLLAWVINIYVASTKWM 358
L Y++ CG H+ F +LQ ++ R +RS + C+A + +I++Y+A+ K M
Sbjct: 275 LRYVLQQSNCGSHE--FPTLQLPYERLRNALRSALVRRVCHAGATTSQIIDVYIATIKVM 332

Query: 359 RI 364
R+
Sbjct: 333 RV 334