BP917798
Clone id YMU001_000105_E12
Library
Length 209
Definition Adiantum capillus-veneris mRNA. clone: YMU001_000105_E12.
Accession
Tissue type prothallium
Developmental stage -
Contig ID -
Sequence
GGTGCTGCCAGAATATGAAGATGCCGGCGGTGCCATTGAGGATATGAGCTCTTGAATGCT
TGTTGTTCCAACAGCATCCATGAATCTGCTGCTGCTGCTGAGCTTCTGGAGTGCCTCCCC
AGTGCTATTGATGGCAGAAAGGCTACTTCTGAGTTCATCAAGAGCAGAGGGCTTCTGCTG
GAGGAAGCCATGTCCGGAGCTCTGATTGT
■■Homology search results ■■ -
sp_hit_id A7J1T0
Definition sp|A7J1T0|M313B_XENLA Mitogen-activated protein kinase kinase kinase 13-B OS=Xenopus laevis
Align length 65
Score (bit) 29.3
E-value 6.4
Report
BLASTX 2.2.19 [Nov-02-2008]


Reference: Altschul, Stephen F., Thomas L. Madden, Alejandro A. Schaffer,
Jinghui Zhang, Zheng Zhang, Webb Miller, and David J. Lipman (1997),
"Gapped BLAST and PSI-BLAST: a new generation of protein database search
programs", Nucleic Acids Res. 25:3389-3402.

Query= BP917798|Adiantum capillus-veneris mRNA, clone:
YMU001_000105_E12.
(209 letters)

Database: uniprot_sprot.fasta
412,525 sequences; 148,809,765 total letters

Searching..................................................done



Score E
Sequences producing significant alignments: (bits) Value

sp|A7J1T0|M313B_XENLA Mitogen-activated protein kinase kinase ki... 29 6.4

>sp|A7J1T0|M313B_XENLA Mitogen-activated protein kinase kinase
kinase 13-B OS=Xenopus laevis GN=map3k13-B PE=2 SV=1
Length = 961

Score = 29.3 bits (64), Expect = 6.4
Identities = 21/65 (32%), Positives = 34/65 (52%), Gaps = 2/65 (3%)
Frame = -3

Query: 195 GHGFLQQKPSALDELRSSLSAINSTGEALQKLSSSSR--FMDAVGTTSIQELISSMAPPA 22
GH +++ P D L ++ S +N+T L +S SR F ++V Q+ + AP
Sbjct: 44 GHHEIKETPDKCDFLDNTNSPVNAT--VLNSISEDSRDQFENSVLQLRDQDEPENTAPQG 101

Query: 21 SSYSG 7
SS+SG
Sbjct: 102 SSHSG 106


tr_hit_id B4MJA7
Definition tr|B4MJA7|B4MJA7_DROWI GK10355 OS=Drosophila willistoni
Align length 68
Score (bit) 32.7
E-value 9.1
Report
BLASTX 2.2.19 [Nov-02-2008]


Reference: Altschul, Stephen F., Thomas L. Madden, Alejandro A. Schaffer,
Jinghui Zhang, Zheng Zhang, Webb Miller, and David J. Lipman (1997),
"Gapped BLAST and PSI-BLAST: a new generation of protein database search
programs", Nucleic Acids Res. 25:3389-3402.

Query= BP917798|Adiantum capillus-veneris mRNA, clone:
YMU001_000105_E12.
(209 letters)

Database: uniprot_trembl.fasta
7,341,751 sequences; 2,391,615,440 total letters

Searching..................................................done



Score E
Sequences producing significant alignments: (bits) Value

tr|B4MJA7|B4MJA7_DROWI GK10355 OS=Drosophila willistoni GN=GK103... 33 9.1

>tr|B4MJA7|B4MJA7_DROWI GK10355 OS=Drosophila willistoni GN=GK10355
PE=4 SV=1
Length = 412

Score = 32.7 bits (73), Expect = 9.1
Identities = 24/68 (35%), Positives = 35/68 (51%), Gaps = 1/68 (1%)
Frame = -3

Query: 201 SSGHGFLQQKPSALD-ELRSSLSAINSTGEALQKLSSSSRFMDAVGTTSIQELISSMAPP 25
S GHG L A + +SS S I S+ E + S+S+RF ++S Q+ S AP
Sbjct: 159 SVGHGMLNAAALAQQLKAQSSTSIITSSSEQ-RSSSTSTRFQLTSSSSSTQQAAGSAAPA 217

Query: 24 ASSYSGST 1
++ S ST
Sbjct: 218 VAASSSST 225