BP917811
Clone id YMU001_000105_G04
Library
Length 497
Definition Adiantum capillus-veneris mRNA. clone: YMU001_000105_G04.
Accession
Tissue type prothallium
Developmental stage -
Contig ID
Sequence
ACGGGGCTCCTCCAAGCTTCTCCAAGTAAGGTTGTAGCTGAGATCATGGCGTTTGGATAC
CAATCCAGCAGAGAGTCCTACAATACGCTCTGTATAGGAAGAATACTTCATCCAATCCTG
ACCAAATATAGATGCCCTGGTCACAAAGGCAGCTGGGAAATCTTTAAACCTAGGATAGTA
CAATCCAGCACTGAACTCTGTTGCACCATCCCAGCTATAACTACCAGTGCCATCCCAAGT
TTCTGCACGCCCAAGGAGGTTCTTCAATTTCAAGGACCCTTCAAATATACAATTCCGTGT
CTCAGGCTTGGTGTAAACTCCCATGTCACCAGAGTAGACTCTACTAGGTTCCTTTACACT
CACAATGACATTGGCAGTACCAGGAAGCTCCACAGGCCCAGGCTCAAGACTGATGACACA
CTCTTCAAATATTCCCAGGCTTTCAATATGAGCATTAGCACGCGCAACTTCCTGCAAAAG
CTCATTGGACGTCTTTG
■■Homology search results ■■ -
sp_hit_id Q6AXV4
Definition sp|Q6AXV4|SAM50_RAT Sorting and assembly machinery component 50 homolog OS=Rattus norvegicus
Align length 172
Score (bit) 37.7
E-value 0.029
Report
BLASTX 2.2.19 [Nov-02-2008]


Reference: Altschul, Stephen F., Thomas L. Madden, Alejandro A. Schaffer,
Jinghui Zhang, Zheng Zhang, Webb Miller, and David J. Lipman (1997),
"Gapped BLAST and PSI-BLAST: a new generation of protein database search
programs", Nucleic Acids Res. 25:3389-3402.

Query= BP917811|Adiantum capillus-veneris mRNA, clone:
YMU001_000105_G04.
(497 letters)

Database: uniprot_sprot.fasta
412,525 sequences; 148,809,765 total letters

Searching..................................................done



Score E
Sequences producing significant alignments: (bits) Value

sp|Q6AXV4|SAM50_RAT Sorting and assembly machinery component 50 ... 38 0.029
sp|Q9Y512|SAM50_HUMAN Sorting and assembly machinery component 5... 37 0.039
sp|Q8BGH2|SAM50_MOUSE Sorting and assembly machinery component 5... 37 0.050
sp|Q5T7B8|KIF24_HUMAN Kinesin-like protein KIF24 OS=Homo sapiens... 32 1.2
sp|Q9V784|SAM50_DROME SAM50-like protein CG7639 OS=Drosophila me... 32 2.1
sp|P0C0J5|TPIS_MYCHY Triosephosphate isomerase OS=Mycoplasma hyo... 31 2.8
sp|Q4AAM8|TPIS_MYCHJ Triosephosphate isomerase OS=Mycoplasma hyo... 31 2.8
sp|Q4A8R0|TPIS_MYCH7 Triosephosphate isomerase OS=Mycoplasma hyo... 31 2.8
sp|P0C0J6|TPIS_MYCH2 Triosephosphate isomerase OS=Mycoplasma hyo... 31 2.8
sp|Q5E8Z0|RECF_VIBF1 DNA replication and repair protein recF OS=... 31 2.8
sp|Q97DP4|HCP2_CLOAB Hydroxylamine reductase 2 OS=Clostridium ac... 30 4.7
sp|P09979|KHYB_STRHY Hygromycin-B kinase OS=Streptomyces hygrosc... 30 6.1
sp|Q01978|TFE2_XENLA Transcription factor E2-alpha OS=Xenopus la... 30 8.0
sp|Q12572|LYS2_CANAL L-aminoadipate-semialdehyde dehydrogenase l... 30 8.0
sp|Q9P104|DOK5_HUMAN Docking protein 5 OS=Homo sapiens GN=DOK5 P... 30 8.0

>sp|Q6AXV4|SAM50_RAT Sorting and assembly machinery component 50
homolog OS=Rattus norvegicus GN=Samm50 PE=1 SV=1
Length = 469

Score = 37.7 bits (86), Expect = 0.029
Identities = 54/172 (31%), Positives = 70/172 (40%), Gaps = 15/172 (8%)
Frame = -3

Query: 483 ELLQEVARANAHIESLGIFEECVISLEP--GPVELPGTANVIVSVKEPSRVYSGDMGVYT 310
E+++ A + LGIF + + ++ G LP +V V E R+ G Y
Sbjct: 78 EVMRRSHEAREKLLRLGIFRQVDVLIDTCHGEDALPNGLDVTFEVTELRRL----TGSYN 133

Query: 309 KPETRNCIFEGS----LKLKNLLGRAETWDGTGSYSWDGATEFSAGLYYPRFKDFPAAF- 145
N EGS LKL NLLGRAE SY G E S GL + FK P F
Sbjct: 134 TMVGNN---EGSMVLGLKLPNLLGRAEKVTFQFSY---GTKETSYGLSF--FKPQPGNFE 185

Query: 144 ----VTRASIFGQDWMKYSSYTERIVGLSA----GLVSKRHDLSYNLTWRSL 13
V + GQ +SS E G+SA L H + + WR L
Sbjct: 186 KNFSVNLYKVTGQ--FPWSSLRETDRGVSAEYSFPLCKTSHTVKWEGVWREL 235


>sp|Q9Y512|SAM50_HUMAN Sorting and assembly machinery component 50
homolog OS=Homo sapiens GN=SAMM50 PE=1 SV=3
Length = 469

Score = 37.4 bits (85), Expect = 0.039
Identities = 53/170 (31%), Positives = 72/170 (42%), Gaps = 13/170 (7%)
Frame = -3

Query: 483 ELLQEVARANAHIESLGIFEECVISLEP--GPVELPGTANVIVSVKEPSRVYSGDMGVYT 310
E++++ A + LGIF + + ++ G LP +V V E R+ G Y
Sbjct: 78 EVMRKSHEAREKLLRLGIFRQVDVLIDTCQGDDALPNGLDVTFEVTELRRL----TGSYN 133

Query: 309 KPETRNCIFEGS----LKLKNLLGRAETWDGTGSYSWDGATEFSAGL--YYPRFKDFPAA 148
N EGS LKL NLLGRAE SY G E S GL + PR +F
Sbjct: 134 TMVGNN---EGSMVLGLKLPNLLGRAEKVTFQFSY---GTKETSYGLSFFKPRPGNFERN 187

Query: 147 F-VTRASIFGQDWMKYSSYTERIVGLSA----GLVSKRHDLSYNLTWRSL 13
F V + GQ +SS E G+SA + H + + WR L
Sbjct: 188 FSVNLYKVTGQ--FPWSSLRETDRGMSAEYSFPIWKTSHTVKWEGVWREL 235


>sp|Q8BGH2|SAM50_MOUSE Sorting and assembly machinery component 50
homolog OS=Mus musculus GN=Samm50 PE=1 SV=1
Length = 469

Score = 37.0 bits (84), Expect = 0.050
Identities = 54/172 (31%), Positives = 70/172 (40%), Gaps = 15/172 (8%)
Frame = -3

Query: 483 ELLQEVARANAHIESLGIFEECVISLEP--GPVELPGTANVIVSVKEPSRVYSGDMGVYT 310
E+++ A + LGIF + + ++ G LP +V V E R+ G Y
Sbjct: 78 EVMRRSHEAREKLLRLGIFRQVDVLIDTCHGEDALPNGLDVTFEVTELRRL----TGSYN 133

Query: 309 KPETRNCIFEGS----LKLKNLLGRAETWDGTGSYSWDGATEFSAGLYYPRFKDFPAAF- 145
N EGS LKL NLLGRAE SY G E S GL + FK P F
Sbjct: 134 TMVGNN---EGSMVLGLKLPNLLGRAEKVTFQFSY---GTKETSYGLSF--FKPQPGNFE 185

Query: 144 ----VTRASIFGQDWMKYSSYTERIVGLSA----GLVSKRHDLSYNLTWRSL 13
V + GQ +SS E G+SA L H + + WR L
Sbjct: 186 RNFSVNLYKVTGQ--FPWSSLRETDRGVSAEYSFPLWKTSHTVKWEGVWREL 235


>sp|Q5T7B8|KIF24_HUMAN Kinesin-like protein KIF24 OS=Homo sapiens
GN=KIF24 PE=1 SV=2
Length = 1368

Score = 32.3 bits (72), Expect = 1.2
Identities = 24/68 (35%), Positives = 33/68 (48%)
Frame = +2

Query: 233 SQVSARPRRFFNFKDPSNIQFRVSGLV*TPMSPE*TLLGSFTLTMTLAVPGSSTGPGSRL 412
+ V++R R N P IQ L SP+ LG F ++T+A PGS+ G L
Sbjct: 554 TSVTSRNRTSGN-SSPKRIQSSPGALSEDKCSPKKVKLG-FQQSLTVAAPGSTRGKVHPL 611

Query: 413 MTHSSNIP 436
+H NIP
Sbjct: 612 TSHPPNIP 619


>sp|Q9V784|SAM50_DROME SAM50-like protein CG7639 OS=Drosophila
melanogaster GN=CG7639 PE=2 SV=2
Length = 443

Score = 31.6 bits (70), Expect = 2.1
Identities = 34/118 (28%), Positives = 51/118 (43%), Gaps = 8/118 (6%)
Frame = -3

Query: 495 KTSN--ELLQEVARANAHIESLGIFEECVISLEP--GPVELPGTANVIVSVKEPSRVYSG 328
K SN +L+ E +++ LGIF++ + ++ G P V E SR+
Sbjct: 50 KASNFQDLMLEAMSTKSYLHELGIFKDVSVHIDVSRGADASPQGYEVTFKGNEMSRM--- 106

Query: 327 DMGVYTKPETRNCIFEGSLK----LKNLLGRAETWDGTGSYSWDGATEFSAGLYYPRF 166
MG +N EGSL+ + N+LGR E GSYS A + + P F
Sbjct: 107 -MGSAGTEIGQN---EGSLRTELTIPNILGRGENISLQGSYSSTRANDLQLKFWKPFF 160


>sp|P0C0J5|TPIS_MYCHY Triosephosphate isomerase OS=Mycoplasma
hyopneumoniae GN=tpiA PE=3 SV=1
Length = 242

Score = 31.2 bits (69), Expect = 2.8
Identities = 18/59 (30%), Positives = 30/59 (50%)
Frame = +1

Query: 97 GRILHPILTKYRCPGHKGSWEIFKPRIVQSSTELCCTIPAITTSAIPSFCTPKEVLQFQ 273
G++L + TKY GH EIFK + + ++ + A IP FC + +L+F+
Sbjct: 83 GKMLQDLGTKYVIIGHSERREIFKEKDEELKNKI---LQAQKYDLIPVFCVGESLLEFE 138


>sp|Q4AAM8|TPIS_MYCHJ Triosephosphate isomerase OS=Mycoplasma
hyopneumoniae (strain J / ATCC 25934 / NCTC 10110)
GN=tpiA PE=3 SV=1
Length = 242

Score = 31.2 bits (69), Expect = 2.8
Identities = 18/59 (30%), Positives = 30/59 (50%)
Frame = +1

Query: 97 GRILHPILTKYRCPGHKGSWEIFKPRIVQSSTELCCTIPAITTSAIPSFCTPKEVLQFQ 273
G++L + TKY GH EIFK + + ++ + A IP FC + +L+F+
Sbjct: 83 GKMLQDLGTKYVIIGHSERREIFKEKDEELKNKI---LQAQKYDLIPVFCVGESLLEFE 138


>sp|Q4A8R0|TPIS_MYCH7 Triosephosphate isomerase OS=Mycoplasma
hyopneumoniae (strain 7448) GN=tpiA PE=3 SV=1
Length = 242

Score = 31.2 bits (69), Expect = 2.8
Identities = 18/59 (30%), Positives = 30/59 (50%)
Frame = +1

Query: 97 GRILHPILTKYRCPGHKGSWEIFKPRIVQSSTELCCTIPAITTSAIPSFCTPKEVLQFQ 273
G++L + TKY GH EIFK + + ++ + A IP FC + +L+F+
Sbjct: 83 GKMLQDLGTKYVIIGHSERREIFKEKDEELKNKI---LQAQKYDLIPVFCVGESLLEFE 138


>sp|P0C0J6|TPIS_MYCH2 Triosephosphate isomerase OS=Mycoplasma
hyopneumoniae (strain 232) GN=tpiA PE=3 SV=1
Length = 242

Score = 31.2 bits (69), Expect = 2.8
Identities = 18/59 (30%), Positives = 30/59 (50%)
Frame = +1

Query: 97 GRILHPILTKYRCPGHKGSWEIFKPRIVQSSTELCCTIPAITTSAIPSFCTPKEVLQFQ 273
G++L + TKY GH EIFK + + ++ + A IP FC + +L+F+
Sbjct: 83 GKMLQDLGTKYVIIGHSERREIFKEKDEELKNKI---LQAQKYDLIPVFCVGESLLEFE 138


>sp|Q5E8Z0|RECF_VIBF1 DNA replication and repair protein recF
OS=Vibrio fischeri (strain ATCC 700601 / ES114) GN=recF
PE=3 SV=1
Length = 359

Score = 31.2 bits (69), Expect = 2.8
Identities = 20/71 (28%), Positives = 30/71 (42%)
Frame = +1

Query: 247 TPKEVLQFQGPFKYTIPCLRLGVNSHVTRVDSTRFLYTHNDIGSTRKLHRPRLKTDDTLF 426
TP E + +G K + LRL H+T + +Y +D S HR +L
Sbjct: 264 TPVEDVLSRGQLKLMVCALRLAQGQHLTEATGKQCIYLIDDFASELDSHRRQLLAQYLKQ 323

Query: 427 KYSQAFNMSIS 459
+Q F SI+
Sbjct: 324 TKAQVFISSIT 334


tr_hit_id A9TR39
Definition tr|A9TR39|A9TR39_PHYPA Predicted protein OS=Physcomitrella patens subsp. patens
Align length 164
Score (bit) 196.0
E-value 7.0e-49
Report
BLASTX 2.2.19 [Nov-02-2008]


Reference: Altschul, Stephen F., Thomas L. Madden, Alejandro A. Schaffer,
Jinghui Zhang, Zheng Zhang, Webb Miller, and David J. Lipman (1997),
"Gapped BLAST and PSI-BLAST: a new generation of protein database search
programs", Nucleic Acids Res. 25:3389-3402.

Query= BP917811|Adiantum capillus-veneris mRNA, clone:
YMU001_000105_G04.
(497 letters)

Database: uniprot_trembl.fasta
7,341,751 sequences; 2,391,615,440 total letters

Searching..................................................done



Score E
Sequences producing significant alignments: (bits) Value

tr|A9TR39|A9TR39_PHYPA Predicted protein OS=Physcomitrella paten... 196 7e-49
tr|A9RN88|A9RN88_PHYPA Predicted protein OS=Physcomitrella paten... 192 1e-47
tr|A7Q3L8|A7Q3L8_VITVI Chromosome chr13 scaffold_48, whole genom... 173 4e-42
tr|A5C9V5|A5C9V5_VITVI Putative uncharacterized protein OS=Vitis... 173 4e-42
tr|B4FZ28|B4FZ28_MAIZE Putative uncharacterized protein OS=Zea m... 172 6e-42
tr|Q6ATX4|Q6ATX4_ORYSJ Os05g0470800 protein OS=Oryza sativa subs... 171 2e-41
tr|A2Y5M6|A2Y5M6_ORYSI Putative uncharacterized protein OS=Oryza... 171 2e-41
tr|Q9FFG3|Q9FFG3_ARATH Arabidopsis thaliana genomic DNA, chromos... 154 2e-36
tr|Q8LEH7|Q8LEH7_ARATH Putative uncharacterized protein OS=Arabi... 154 2e-36
tr|Q9SRL6|Q9SRL6_ARATH Putative uncharacterized protein F9F8.12 ... 144 2e-33
tr|A9PF20|A9PF20_POPTR Putative uncharacterized protein OS=Popul... 136 5e-31
tr|B6SPX1|B6SPX1_MAIZE Outer membrane protein, OMP85 family prot... 128 2e-28
tr|Q2RBM6|Q2RBM6_ORYSJ Outer membrane protein, OMP85 family prot... 120 4e-26
tr|Q2QYV1|Q2QYV1_ORYSJ Os12g0105700 protein OS=Oryza sativa subs... 120 4e-26
tr|Q0IV82|Q0IV82_ORYSJ Os11g0106200 protein (Fragment) OS=Oryza ... 120 4e-26
tr|B8BNT7|B8BNT7_ORYSI Putative uncharacterized protein OS=Oryza... 120 4e-26
tr|B8BNT0|B8BNT0_ORYSI Putative uncharacterized protein OS=Oryza... 120 4e-26
tr|B7EKD0|B7EKD0_ORYSJ cDNA clone:J013119I16, full insert sequen... 120 4e-26
tr|B7ECH1|B7ECH1_ORYSJ cDNA clone:J013071M22, full insert sequen... 120 4e-26
tr|A3CE62|A3CE62_ORYSJ Putative uncharacterized protein OS=Oryza... 120 4e-26
tr|A3C7T7|A3C7T7_ORYSJ Putative uncharacterized protein OS=Oryza... 99 1e-19
tr|B4FIX9|B4FIX9_MAIZE Putative uncharacterized protein OS=Zea m... 49 1e-04
tr|Q5KEW4|Q5KEW4_CRYNE Mitochondrion protein, putative OS=Crypto... 45 0.002
tr|Q4UAZ3|Q4UAZ3_THEAN Putative uncharacterized protein OS=Theil... 44 0.006
tr|B0DVC0|B0DVC0_LACBS Predicted protein OS=Laccaria bicolor (st... 43 0.007
tr|Q6ARL5|Q6ARL5_DESPS Related to outer membrane protein OS=Desu... 42 0.016
tr|Q1MB17|Q1MB17_RHIL3 Putative cell surface protein OS=Rhizobiu... 39 0.14
tr|B5ZSL3|B5ZSL3_RHILW Surface antigen (D15) OS=Rhizobium legumi... 39 0.14
tr|Q4TBF8|Q4TBF8_TETNG Chromosome undetermined SCAF7131, whole g... 38 0.23
tr|Q2K3J1|Q2K3J1_RHIEC Putative outer membrane protein, protecti... 38 0.23

>tr|A9TR39|A9TR39_PHYPA Predicted protein OS=Physcomitrella patens
subsp. patens GN=PHYPADRAFT_224626 PE=4 SV=1
Length = 471

Score = 196 bits (497), Expect = 7e-49
Identities = 92/164 (56%), Positives = 121/164 (73%), Gaps = 1/164 (0%)
Frame = -3

Query: 492 TSNELLQEVARANAHIESLGIFEECVISLEPGPVELPGTANVIVSVKEPSRVYSGDMGVY 313
T ELLQE RAN+ + +LGIF++CVI+L+ GP ELPGTANVI+ V+E R++SGD+G++
Sbjct: 45 TMQELLQECVRANSRLRALGIFDKCVITLDAGPQELPGTANVILEVEEVKRLFSGDLGMF 104

Query: 312 TKPETRNCIFEGSLKLKNLLGRAETWDGTGSYSWDGATEFSAGLYYPRFKDFPAAFVTRA 133
+KPET+ EG++K KNL G AET D TG Y D +E SAG+ YPRFK PA+ TR
Sbjct: 105 SKPETKAWTLEGTVKYKNLAGLAETLDATGCYGLDTTSELSAGVTYPRFKGLPASLATRL 164

Query: 132 SIFGQDWMKYSSYTERIVGLSAGLV-SKRHDLSYNLTWRSLEEP 4
++ QDW +YSSY ER+ G S GLV +HD+SYNLTWR L++P
Sbjct: 165 TLLTQDWQRYSSYRERLTGFSVGLVGDNQHDISYNLTWRDLKDP 208


>tr|A9RN88|A9RN88_PHYPA Predicted protein OS=Physcomitrella patens
subsp. patens GN=PHYPADRAFT_116967 PE=4 SV=1
Length = 488

Score = 192 bits (487), Expect = 1e-47
Identities = 93/164 (56%), Positives = 119/164 (72%), Gaps = 1/164 (0%)
Frame = -3

Query: 492 TSNELLQEVARANAHIESLGIFEECVISLEPGPVELPGTANVIVSVKEPSRVYSGDMGVY 313
T +LLQ+ A AN+ + +LGIF+ CVI+L+ GP ELPGTANVIV V+E R +SGD+GV+
Sbjct: 62 TMQDLLQKSAHANSRLRALGIFDSCVITLDAGPEELPGTANVIVEVEEAKRPFSGDLGVF 121

Query: 312 TKPETRNCIFEGSLKLKNLLGRAETWDGTGSYSWDGATEFSAGLYYPRFKDFPAAFVTRA 133
+KPET+ EG +K KNL G AET D TG Y D +E SAG+ YPRFK PA+ VTR
Sbjct: 122 SKPETKAWTLEGLVKYKNLSGFAETIDATGCYGLDTTSELSAGVTYPRFKGLPASLVTRL 181

Query: 132 SIFGQDWMKYSSYTERIVGLSAGLV-SKRHDLSYNLTWRSLEEP 4
++ QDW +YSSY ER+ G S GLV +HD+SYNLTWR L++P
Sbjct: 182 TLLTQDWKRYSSYRERLTGFSVGLVGDDQHDISYNLTWRDLKDP 225


>tr|A7Q3L8|A7Q3L8_VITVI Chromosome chr13 scaffold_48, whole genome
shotgun sequence OS=Vitis vinifera GN=GSVIVT00029336001
PE=4 SV=1
Length = 464

Score = 173 bits (439), Expect = 4e-42
Identities = 85/164 (51%), Positives = 108/164 (65%), Gaps = 1/164 (0%)
Frame = -3

Query: 492 TSNELLQEVARANAHIESLGIFEECVISLEPGPVELPGTANVIVSVKEPSRVYSGDMGVY 313
T ELL+ AN S GIF+ I+L+ GP ELPGT NVIV V E +GD+G++
Sbjct: 42 TMQELLKAAGIANHRFHSFGIFDSVGITLDCGPPELPGTVNVIVDVVETKNPLTGDLGIF 101

Query: 312 TKPETRNCIFEGSLKLKNLLGRAETWDGTGSYSWDGATEFSAGLYYPRFKDFPAAFVTRA 133
TKPE R EGSLKLKNL G + WDG+ Y WD ++E SAG+ PRFK + R
Sbjct: 102 TKPEARTWSLEGSLKLKNLFGYGDLWDGSLVYGWDQSSEISAGVSLPRFKGMVTPMLARV 161

Query: 132 SIFGQDWMKYSSYTERIVGLSAGLVS-KRHDLSYNLTWRSLEEP 4
S+ QDW+K+SSY ER +GL+ GL+S KRHDL+YNL WR+L +P
Sbjct: 162 SLLSQDWLKFSSYKERSLGLNLGLISTKRHDLTYNLLWRTLTDP 205


>tr|A5C9V5|A5C9V5_VITVI Putative uncharacterized protein OS=Vitis
vinifera GN=VITISV_041873 PE=4 SV=1
Length = 564

Score = 173 bits (439), Expect = 4e-42
Identities = 85/164 (51%), Positives = 108/164 (65%), Gaps = 1/164 (0%)
Frame = -3

Query: 492 TSNELLQEVARANAHIESLGIFEECVISLEPGPVELPGTANVIVSVKEPSRVYSGDMGVY 313
T ELL+ AN S GIF+ I+L+ GP ELPGT NVIV V E +GD+G++
Sbjct: 112 TMQELLKAAGIANHRFHSFGIFDSVGITLDCGPPELPGTVNVIVDVVETKNPLTGDLGIF 171

Query: 312 TKPETRNCIFEGSLKLKNLLGRAETWDGTGSYSWDGATEFSAGLYYPRFKDFPAAFVTRA 133
TKPE R EGSLKLKNL G + WDG+ Y WD ++E SAG+ PRFK + R
Sbjct: 172 TKPEARTWSLEGSLKLKNLFGYGDLWDGSLVYGWDQSSEISAGVSLPRFKGMVTPMLARV 231

Query: 132 SIFGQDWMKYSSYTERIVGLSAGLVS-KRHDLSYNLTWRSLEEP 4
S+ QDW+K+SSY ER +GL+ GL+S KRHDL+YNL WR+L +P
Sbjct: 232 SLLSQDWLKFSSYKERSLGLNLGLISTKRHDLTYNLLWRTLTDP 275


>tr|B4FZ28|B4FZ28_MAIZE Putative uncharacterized protein OS=Zea mays
PE=2 SV=1
Length = 401

Score = 172 bits (437), Expect = 6e-42
Identities = 83/164 (50%), Positives = 109/164 (66%), Gaps = 1/164 (0%)
Frame = -3

Query: 492 TSNELLQEVARANAHIESLGIFEECVISLEPGPVELPGTANVIVSVKEPSRVYSGDMGVY 313
T +LL+ + A A + L IF+ I+L+ GP ELPGT NV++ V E + +G GVY
Sbjct: 106 TVQDLLRAASVATARLHDLDIFDAVKITLDAGPPELPGTTNVVIEVVEVANPLTGTAGVY 165

Query: 312 TKPETRNCIFEGSLKLKNLLGRAETWDGTGSYSWDGATEFSAGLYYPRFKDFPAAFVTRA 133
+KPE R+ EGSLKLKNL G + WD +GS+ WD TE G+ PRFK P + RA
Sbjct: 166 SKPEARSWSLEGSLKLKNLFGYGDIWDASGSFGWDQTTEVGVGVCLPRFKSIPTPLMARA 225

Query: 132 SIFGQDWMKYSSYTERIVGLSAGLVSKR-HDLSYNLTWRSLEEP 4
S+ QDW+K+SSY ER++GLS GL+S R HDLSYNL WR+L +P
Sbjct: 226 SLSSQDWLKFSSYKERLLGLSFGLLSTRNHDLSYNLAWRTLTDP 269


>tr|Q6ATX4|Q6ATX4_ORYSJ Os05g0470800 protein OS=Oryza sativa subsp.
japonica GN=P0015C02.2 PE=4 SV=1
Length = 520

Score = 171 bits (433), Expect = 2e-41
Identities = 81/164 (49%), Positives = 111/164 (67%), Gaps = 1/164 (0%)
Frame = -3

Query: 492 TSNELLQEVARANAHIESLGIFEECVISLEPGPVELPGTANVIVSVKEPSRVYSGDMGVY 313
T +LL+ + A+A + L +F+ I+L+ GP ELPGT NV+V V E + +G GVY
Sbjct: 98 TVQDLLRNASIASARLRQLDVFDSVNITLDAGPPELPGTTNVVVEVVEAANPITGSAGVY 157

Query: 312 TKPETRNCIFEGSLKLKNLLGRAETWDGTGSYSWDGATEFSAGLYYPRFKDFPAAFVTRA 133
+KPE R+ EGS+KLKNL G + WD +G+YSWD +E G+ PRFK + RA
Sbjct: 158 SKPEARSWSLEGSVKLKNLFGYGDIWDASGAYSWDQTSEVGIGVSLPRFKSISTPLMARA 217

Query: 132 SIFGQDWMKYSSYTERIVGLSAGLVS-KRHDLSYNLTWRSLEEP 4
S+ QDW+K+SSY ER++GLS GL+S +HDLSYNLTWR+L +P
Sbjct: 218 SLSSQDWLKFSSYKERLLGLSFGLISTMQHDLSYNLTWRTLTDP 261


>tr|A2Y5M6|A2Y5M6_ORYSI Putative uncharacterized protein OS=Oryza
sativa subsp. indica GN=OsI_20297 PE=4 SV=1
Length = 520

Score = 171 bits (433), Expect = 2e-41
Identities = 81/164 (49%), Positives = 111/164 (67%), Gaps = 1/164 (0%)
Frame = -3

Query: 492 TSNELLQEVARANAHIESLGIFEECVISLEPGPVELPGTANVIVSVKEPSRVYSGDMGVY 313
T +LL+ + A+A + L +F+ I+L+ GP ELPGT NV+V V E + +G GVY
Sbjct: 98 TVQDLLRNASIASARLRQLDVFDSVNITLDAGPPELPGTTNVVVEVVEAANPITGSAGVY 157

Query: 312 TKPETRNCIFEGSLKLKNLLGRAETWDGTGSYSWDGATEFSAGLYYPRFKDFPAAFVTRA 133
+KPE R+ EGS+KLKNL G + WD +G+YSWD +E G+ PRFK + RA
Sbjct: 158 SKPEARSWSLEGSVKLKNLFGYGDIWDASGAYSWDQTSEVGIGVSLPRFKSISTPLMARA 217

Query: 132 SIFGQDWMKYSSYTERIVGLSAGLVS-KRHDLSYNLTWRSLEEP 4
S+ QDW+K+SSY ER++GLS GL+S +HDLSYNLTWR+L +P
Sbjct: 218 SLSSQDWLKFSSYKERLLGLSFGLISTMQHDLSYNLTWRTLTDP 261


>tr|Q9FFG3|Q9FFG3_ARATH Arabidopsis thaliana genomic DNA, chromosome
5, P1 clone:MOP10 (Putative uncharacterized protein
MOP10.6) OS=Arabidopsis thaliana GN=MOP10.6 PE=2 SV=1
Length = 524

Score = 154 bits (389), Expect = 2e-36
Identities = 74/164 (45%), Positives = 106/164 (64%), Gaps = 1/164 (0%)
Frame = -3

Query: 492 TSNELLQEVARANAHIESLGIFEECVISLEPGPVELPGTANVIVSVKEPSRVYSGDMGVY 313
T ELL+ AN ++++L IF+ I+L+ GP ELPGT NV++ V E +G +G +
Sbjct: 104 TLQELLKASKVANFNLQALDIFDSVKITLDSGPPELPGTTNVVIDVVESKSPITGQIGTF 163

Query: 312 TKPETRNCIFEGSLKLKNLLGRAETWDGTGSYSWDGATEFSAGLYYPRFKDFPAAFVTRA 133
TK E R+ EGSLK KN+ G + WDG+ +Y D + E G+Y PRF+ P F +R
Sbjct: 164 TKAEARSSSLEGSLKYKNIFGYGDIWDGSLAYGCDHSAEVGLGMYLPRFRGRPTPFTSRV 223

Query: 132 SIFGQDWMKYSSYTERIVGLSAGLV-SKRHDLSYNLTWRSLEEP 4
+ QDW+K+SSY ER +GLS GL+ SK H+L+YN+ WR+L +P
Sbjct: 224 YLSTQDWLKFSSYKERALGLSLGLIASKYHELAYNIAWRNLIDP 267


>tr|Q8LEH7|Q8LEH7_ARATH Putative uncharacterized protein
OS=Arabidopsis thaliana PE=2 SV=1
Length = 524

Score = 154 bits (389), Expect = 2e-36
Identities = 74/164 (45%), Positives = 106/164 (64%), Gaps = 1/164 (0%)
Frame = -3

Query: 492 TSNELLQEVARANAHIESLGIFEECVISLEPGPVELPGTANVIVSVKEPSRVYSGDMGVY 313
T ELL+ AN ++++L IF+ I+L+ GP ELPGT NV++ V E +G +G +
Sbjct: 104 TLQELLKASKVANFNLQALDIFDSVKITLDSGPPELPGTTNVVIDVVESKSPITGQIGTF 163

Query: 312 TKPETRNCIFEGSLKLKNLLGRAETWDGTGSYSWDGATEFSAGLYYPRFKDFPAAFVTRA 133
TK E R+ EGSLK KN+ G + WDG+ +Y D + E G+Y PRF+ P F +R
Sbjct: 164 TKAEARSSSLEGSLKYKNIFGYGDIWDGSLAYGCDHSAEVGLGMYLPRFRGRPTPFTSRV 223

Query: 132 SIFGQDWMKYSSYTERIVGLSAGLV-SKRHDLSYNLTWRSLEEP 4
+ QDW+K+SSY ER +GLS GL+ SK H+L+YN+ WR+L +P
Sbjct: 224 YLSTQDWLKFSSYKERALGLSLGLIASKYHELAYNIAWRNLIDP 267


>tr|Q9SRL6|Q9SRL6_ARATH Putative uncharacterized protein F9F8.12
(Putative uncharacterized protein At3g11070) (Putative
uncharacterized protein F11B9.3) OS=Arabidopsis thaliana
GN=F11B9.3 PE=2 SV=1
Length = 520

Score = 144 bits (363), Expect = 2e-33
Identities = 71/164 (43%), Positives = 100/164 (60%), Gaps = 1/164 (0%)
Frame = -3

Query: 492 TSNELLQEVARANAHIESLGIFEECVISLEPGPVELPGTANVIVSVKEPSRVYSGDMGVY 313
T ELL+ AN+++ +L IF+ I+L+ GP ELPGT NV++ V E +G +G Y
Sbjct: 107 TLQELLEASRVANSNLRALDIFDSVNITLDSGPPELPGTTNVVIDVVESKSPLTGQIGAY 166

Query: 312 TKPETRNCIFEGSLKLKNLLGRAETWDGTGSYSWDGATEFSAGLYYPRFKDFPAAFVTRA 133
T+ E R+ E SLK KN+ G + WDG+ Y D + E G+Y PRF+ F +R
Sbjct: 167 TRAEARSSSVEASLKYKNIFGYGDIWDGSIVYGCDNSAEVGLGMYLPRFRGLSTPFTSRL 226

Query: 132 SIFGQDWMKYSSYTERIVGLSAGLV-SKRHDLSYNLTWRSLEEP 4
+ QDW+K+SSY ER +GLS GL SK H+L Y + WR+L +P
Sbjct: 227 FLSTQDWLKFSSYKERSLGLSLGLFSSKYHELIYTIAWRNLIDP 270