BP917816
Clone id YMU001_000105_G09
Library
Length 458
Definition Adiantum capillus-veneris mRNA. clone: YMU001_000105_G09.
Accession
Tissue type prothallium
Developmental stage -
Contig ID -
Sequence
CGCGGCCGCAGGAATTTTTTTTTTTTTTGGCACAATGTTCGATGACTTCATGAAGACAAA
TAAATATGATCTTTTTCAGAGCACCATTACATGTACCTTTGCTAACAAAATCGTCTCAAA
ACTGTTATGCTACAGTAAAATACAGTCTTTACACAATCCCAACGGAATTCCACTTGATAC
GTCAAACCAGAAACCTTTCATCACAATATAATGCAGCAACCTTACACACAGCCATGCAAT
AGGCAGAACCCACCGTCACTGGTTACTACAAAAGAATGCTCTATATTGAACAACAGCATA
ATGGACTCCAGCATTTGTAATGGGCTTTGCATCCAGCATGCGTCGAAGAAGCGTACCTGG
CTTCTGCGTTGTTCTCACTTATAGAAACCCACCTCCCCTTGAAAGCTTGAGCAACCCCAT
ATCCAACCGAGGCTTAGGTTTGGATATTAGACTTTTCC
■■Homology search results ■■ -
sp_hit_id Q058G2
Definition sp|Q058G2|MNMG_BUCCC tRNA uridine 5-carboxymethylaminomethyl modification enzyme mnmG OS=Buchnera aphidicola subsp. Cinara cedri
Align length 39
Score (bit) 31.2
E-value 1.8
Report
BLASTX 2.2.19 [Nov-02-2008]


Reference: Altschul, Stephen F., Thomas L. Madden, Alejandro A. Schaffer,
Jinghui Zhang, Zheng Zhang, Webb Miller, and David J. Lipman (1997),
"Gapped BLAST and PSI-BLAST: a new generation of protein database search
programs", Nucleic Acids Res. 25:3389-3402.

Query= BP917816|Adiantum capillus-veneris mRNA, clone:
YMU001_000105_G09.
(430 letters)

Database: uniprot_sprot.fasta
412,525 sequences; 148,809,765 total letters

Searching..................................................done



Score E
Sequences producing significant alignments: (bits) Value

sp|Q058G2|MNMG_BUCCC tRNA uridine 5-carboxymethylaminomethyl mod... 31 1.8
sp|P19711|POLG_BVDVN Genome polyprotein OS=Bovine viral diarrhea... 31 2.5
sp|Q46628|AMSG_ERWAM UDP-galactose-lipid carrier transferase OS=... 30 3.1
sp|Q57491|Y872_HAEIN Uncharacterized sugar transferase HI0872 OS... 30 5.3
sp|Q041U1|FPG_LACGA Formamidopyrimidine-DNA glycosylase OS=Lacto... 29 7.1
sp|A4QKQ3|YCF1_CAPBU Putative membrane protein ycf1 OS=Capsella ... 29 9.3
sp|A4QK78|YCF1_ARAHI Putative membrane protein ycf1 OS=Arabis hi... 29 9.3
sp|Q74IB5|FPG_LACJO Formamidopyrimidine-DNA glycosylase OS=Lacto... 29 9.3

>sp|Q058G2|MNMG_BUCCC tRNA uridine 5-carboxymethylaminomethyl
modification enzyme mnmG OS=Buchnera aphidicola subsp.
Cinara cedri GN=mnmG PE=3 SV=1
Length = 634

Score = 31.2 bits (69), Expect = 1.8
Identities = 14/39 (35%), Positives = 24/39 (61%)
Frame = +3

Query: 78 QNRLKTVMLQ*NTVFTQSQRNST*YVKPETFHHNIMQQP 194
+NRLK ++LQ TVF S T Y+K + +++++P
Sbjct: 477 RNRLKNIILQPKTVFFSSNNKKTIYLKKKCTAFDLLRRP 515


>sp|P19711|POLG_BVDVN Genome polyprotein OS=Bovine viral diarrhea
virus (isolate NADL) PE=1 SV=2
Length = 3988

Score = 30.8 bits (68), Expect = 2.5
Identities = 25/75 (33%), Positives = 36/75 (48%), Gaps = 6/75 (8%)
Frame = -1

Query: 301 QSPLQMLESIMLLFNIEHSFVVT-SDGGFCLLHGCV*GCCIIL**KVSGLTYQVEFRW-- 131
++PL++ E + + VT SDG ++ C+ GC II K + +YQ FRW
Sbjct: 100 RAPLELFEEGSMCETTKRIGRVTGSDGKLYHIYVCIDGCIII---KSATRSYQRVFRWVH 156

Query: 130 ---DCVKTVFYCSIT 95
DC V CS T
Sbjct: 157 NRLDCPLWVTTCSDT 171


>sp|Q46628|AMSG_ERWAM UDP-galactose-lipid carrier transferase
OS=Erwinia amylovora GN=amsG PE=3 SV=1
Length = 477

Score = 30.4 bits (67), Expect = 3.1
Identities = 11/24 (45%), Positives = 15/24 (62%)
Frame = -3

Query: 221 VLPIAWLCVRLLHYIVMKGFWFDV 150
V+ + W VRL HY K FWF++
Sbjct: 64 VICVGWFWVRLRHYTYRKPFWFEL 87


>sp|Q57491|Y872_HAEIN Uncharacterized sugar transferase HI0872
OS=Haemophilus influenzae GN=HI0872 PE=3 SV=1
Length = 471

Score = 29.6 bits (65), Expect = 5.3
Identities = 9/21 (42%), Positives = 13/21 (61%)
Frame = -3

Query: 212 IAWLCVRLLHYIVMKGFWFDV 150
+ W +RL HY K FWF++
Sbjct: 61 VGWFAIRLRHYTYRKPFWFEL 81


>sp|Q041U1|FPG_LACGA Formamidopyrimidine-DNA glycosylase
OS=Lactobacillus gasseri (strain ATCC 33323 / DSM 20243)
GN=mutM PE=3 SV=1
Length = 276

Score = 29.3 bits (64), Expect = 7.1
Identities = 21/68 (30%), Positives = 26/68 (38%)
Frame = +1

Query: 25 KTNKYDLFQSTITCTFANKIVSKLLCYSKIQSLHNPNGIPLDTSNQKPFITI*CSNLTHS 204
K K L TI C N V ++L SKI L + IP D N+ H+
Sbjct: 156 KNIKNTLLDQTIVCGLGNIYVDEVLWKSKIHPLSSAKAIPADKVKNL------YQNINHT 209

Query: 205 HAIGRTHR 228
AI R
Sbjct: 210 IAIATKER 217


>sp|A4QKQ3|YCF1_CAPBU Putative membrane protein ycf1 OS=Capsella
bursa-pastoris GN=ycf1-A PE=3 SV=1
Length = 1789

Score = 28.9 bits (63), Expect = 9.3
Identities = 13/40 (32%), Positives = 21/40 (52%)
Frame = +1

Query: 34 KYDLFQSTITCTFANKIVSKLLCYSKIQSLHNPNGIPLDT 153
+Y FQ C F KI++ + Y + L+NPN I + +
Sbjct: 1548 RYSRFQLRWNCFFNQKILNNVKVYCLLVRLNNPNEIAISS 1587


>sp|A4QK78|YCF1_ARAHI Putative membrane protein ycf1 OS=Arabis hirsuta
GN=ycf1-A PE=3 SV=1
Length = 1778

Score = 28.9 bits (63), Expect = 9.3
Identities = 13/45 (28%), Positives = 22/45 (48%)
Frame = +1

Query: 19 FMKTNKYDLFQSTITCTFANKIVSKLLCYSKIQSLHNPNGIPLDT 153
++ +Y FQ C F KI++ + Y + L NPN I + +
Sbjct: 1550 YLFLTRYSRFQLRWNCFFNQKILNNIKVYCLLVRLKNPNEIAISS 1594


>sp|Q74IB5|FPG_LACJO Formamidopyrimidine-DNA glycosylase
OS=Lactobacillus johnsonii GN=mutM PE=3 SV=3
Length = 276

Score = 28.9 bits (63), Expect = 9.3
Identities = 15/42 (35%), Positives = 19/42 (45%)
Frame = +1

Query: 25 KTNKYDLFQSTITCTFANKIVSKLLCYSKIQSLHNPNGIPLD 150
K K L T+ C N V ++L SKI L + IP D
Sbjct: 156 KNIKNTLLDQTVVCGLGNIYVDEVLWQSKIHPLSSAKSIPAD 197


tr_hit_id Q7VRC2
Definition tr|Q7VRC2|Q7VRC2_BLOFL Rod shape-determining protein MreD OS=Blochmannia floridanus
Align length 79
Score (bit) 35.0
E-value 1.9
Report
BLASTX 2.2.19 [Nov-02-2008]


Reference: Altschul, Stephen F., Thomas L. Madden, Alejandro A. Schaffer,
Jinghui Zhang, Zheng Zhang, Webb Miller, and David J. Lipman (1997),
"Gapped BLAST and PSI-BLAST: a new generation of protein database search
programs", Nucleic Acids Res. 25:3389-3402.

Query= BP917816|Adiantum capillus-veneris mRNA, clone:
YMU001_000105_G09.
(430 letters)

Database: uniprot_trembl.fasta
7,341,751 sequences; 2,391,615,440 total letters

Searching..................................................done



Score E
Sequences producing significant alignments: (bits) Value

tr|Q7VRC2|Q7VRC2_BLOFL Rod shape-determining protein MreD OS=Blo... 35 1.9
tr|Q9FN24|Q9FN24_ARATH Similarity to CHP-rich zinc finger protei... 34 3.2
tr|Q16XT3|Q16XT3_AEDAE Laminin A chain, putative OS=Aedes aegypt... 33 5.5
tr|B0WAD7|B0WAD7_CULQU Laminin subunit alpha OS=Culex quinquefas... 33 7.2

>tr|Q7VRC2|Q7VRC2_BLOFL Rod shape-determining protein MreD
OS=Blochmannia floridanus GN=mreD PE=4 SV=1
Length = 162

Score = 35.0 bits (79), Expect = 1.9
Identities = 21/79 (26%), Positives = 41/79 (51%)
Frame = -3

Query: 266 VVQYRAFFCSNQ*RWVLPIAWLCVRLLHYIVMKGFWFDVSSGIPLGLCKDCILL*HNSFE 87
++QY FF W L +W + L+++IV+ ++ +G LGL DCI +
Sbjct: 21 ILQYVLFFSIT---WYLQPSWTMMLLIYWIVLIPNKINIGTGFFLGLILDCISCSTLGIQ 77

Query: 86 TILLAKVHVMVL*KRSYLF 30
T+ ++ + + + ++ YLF
Sbjct: 78 TLSMSIISYLTI-RKIYLF 95


>tr|Q9FN24|Q9FN24_ARATH Similarity to CHP-rich zinc finger protein
OS=Arabidopsis thaliana GN=At5g54030 PE=4 SV=1
Length = 419

Score = 34.3 bits (77), Expect = 3.2
Identities = 14/28 (50%), Positives = 18/28 (64%)
Frame = +3

Query: 162 ETFHHNIMQQPYTQPCNRQNPPSLVTTK 245
E FHH++ Q PYT PC ++ LVT K
Sbjct: 392 EPFHHDLHQHPYTLPCKVRDDVRLVTKK 419


>tr|Q16XT3|Q16XT3_AEDAE Laminin A chain, putative OS=Aedes aegypti
GN=AAEL008773 PE=4 SV=1
Length = 3701

Score = 33.5 bits (75), Expect = 5.5
Identities = 20/53 (37%), Positives = 30/53 (56%)
Frame = -3

Query: 401 RLDMGLLKLSRGGGFL*VRTTQKPGTLLRRMLDAKPITNAGVHYAVVQYRAFF 243
+++ GL +GGGF+ +R K GT L +D KP + G+ +V RAFF
Sbjct: 3521 QIETGLF-FGKGGGFVKLREKFKVGTELTVSMDIKPRSTTGLLMSVHGKRAFF 3572


>tr|B0WAD7|B0WAD7_CULQU Laminin subunit alpha OS=Culex
quinquefasciatus GN=CpipJ_CPIJ003989 PE=4 SV=1
Length = 3706

Score = 33.1 bits (74), Expect = 7.2
Identities = 19/43 (44%), Positives = 25/43 (58%)
Frame = -3

Query: 371 RGGGFL*VRTTQKPGTLLRRMLDAKPITNAGVHYAVVQYRAFF 243
+GGGFL +R K GT L +D KP + G+ +V RAFF
Sbjct: 3535 KGGGFLKLREKFKVGTELTVSMDIKPRSPTGLLMSVHGKRAFF 3577