BP917818
Clone id YMU001_000105_H01
Library
Length 533
Definition Adiantum capillus-veneris mRNA. clone: YMU001_000105_H01.
Accession
Tissue type prothallium
Developmental stage -
Contig ID
Sequence
TTGGACAACTCTTGGTTTATTTCCAACAAGAAAAAAACTATGAATCACAAAATCTCGTTC
AATCTATCGACTGCTAGGCGACATGACAAGAGAATATCAACAAAGCTTGTATTATCACAA
GTTCGATATCAGGAATCAGGTTCCACCACATCTGGCTTATAATGCCACTACCTTGTAAAG
GCCTTGCTCCAGCCTCTTTGATACGTCTACAAAATGAAGAAGGGCTACTTGCACTCCTTC
GTTCCTGCAAGAGCTATGATGCTATGTGAACAACACTTCGGAAAGAAAATGCCAGTAGTT
TCCTCGATACAATTGCCATGGGAGCCAACTGCTGGGATAGGCTATGTTATATGTTAAAGT
TTGCAAACAGTCAAAGAGTTCCTCTCCAGACTCACGCGATAGCCACAGAATGACTATCAA
GTAAACCGACCGGAGCCACTGCATTTATGGCTGCACCTCTTCTCATCAGTTCGTGATCCA
AAAACACCACAATAACTGTGATATCGTCATGAAAATGACGTCTCACGCCTCTC
■■Homology search results ■■ -
sp_hit_id Q5Z8P0
Definition sp|Q5Z8P0|P2C60_ORYSJ Probable protein phosphatase 2C 60 OS=Oryza sativa subsp. japonica
Align length 27
Score (bit) 46.6
E-value 8.0e-05
Report
BLASTX 2.2.19 [Nov-02-2008]


Reference: Altschul, Stephen F., Thomas L. Madden, Alejandro A. Schaffer,
Jinghui Zhang, Zheng Zhang, Webb Miller, and David J. Lipman (1997),
"Gapped BLAST and PSI-BLAST: a new generation of protein database search
programs", Nucleic Acids Res. 25:3389-3402.

Query= BP917818|Adiantum capillus-veneris mRNA, clone:
YMU001_000105_H01.
(533 letters)

Database: uniprot_sprot.fasta
412,525 sequences; 148,809,765 total letters

Searching..................................................done



Score E
Sequences producing significant alignments: (bits) Value

sp|Q5Z8P0|P2C60_ORYSJ Probable protein phosphatase 2C 60 OS=Oryz... 47 8e-05
sp|Q7XUC5|P2C43_ORYSJ Probable protein phosphatase 2C 43 OS=Oryz... 47 8e-05
sp|Q6ZHC8|P2C25_ORYSJ Probable protein phosphatase 2C 25 OS=Oryz... 46 1e-04
sp|Q10S32|P2C28_ORYSJ Probable protein phosphatase 2C 28 OS=Oryz... 43 8e-04
sp|Q94H98|P2C34_ORYSJ Probable protein phosphatase 2C 34 OS=Oryz... 42 0.002
sp|Q5MFV5|P2C34_ORYSI Probable protein phosphatase 2C 34 OS=Oryz... 42 0.002
sp|Q7XHN8|P2C61_ORYSJ Probable protein phosphatase 2C 61 OS=Oryz... 42 0.002
sp|Q7XCJ7|P2C72_ORYSJ Probable protein phosphatase 2C 72 OS=Oryz... 41 0.003
sp|Q2QN36|P2C78_ORYSJ Probable protein phosphatase 2C 78 OS=Oryz... 40 0.009
sp|Q7Y138|P2C36_ORYSJ Probable protein phosphatase 2C 36 OS=Oryz... 39 0.012
sp|Q8H063|P2C29_ORYSJ Probable protein phosphatase 2C 29 OS=Oryz... 38 0.027
sp|P31979|NUOF_ECOLI NADH-quinone oxidoreductase subunit F OS=Es... 30 5.6
sp|P33901|NUOF_SALTY NADH-quinone oxidoreductase subunit F OS=Sa... 30 7.3

>sp|Q5Z8P0|P2C60_ORYSJ Probable protein phosphatase 2C 60 OS=Oryza
sativa subsp. japonica GN=Os06g0717800 PE=2 SV=1
Length = 392

Score = 46.6 bits (109), Expect = 8e-05
Identities = 21/27 (77%), Positives = 23/27 (85%)
Frame = -2

Query: 532 RGVRRHFHDDITVIVVFLDHELMRRGA 452
RGVRRHFHDDITVIVVFLD L+ R +
Sbjct: 338 RGVRRHFHDDITVIVVFLDSSLVSRAS 364


>sp|Q7XUC5|P2C43_ORYSJ Probable protein phosphatase 2C 43 OS=Oryza
sativa subsp. japonica GN=Os04g0584366 PE=2 SV=2
Length = 388

Score = 46.6 bits (109), Expect = 8e-05
Identities = 19/26 (73%), Positives = 24/26 (92%)
Frame = -2

Query: 532 RGVRRHFHDDITVIVVFLDHELMRRG 455
+GVRR FHDDITV+VVF+DHEL++ G
Sbjct: 335 KGVRRFFHDDITVVVVFIDHELLQDG 360


>sp|Q6ZHC8|P2C25_ORYSJ Probable protein phosphatase 2C 25 OS=Oryza
sativa subsp. japonica GN=Os02g0685600 PE=2 SV=1
Length = 387

Score = 45.8 bits (107), Expect = 1e-04
Identities = 20/41 (48%), Positives = 32/41 (78%), Gaps = 1/41 (2%)
Frame = -2

Query: 532 RGVRRHFHDDITVIVVFLDHELMR-RGAAINAVAPVGLLDS 413
+GVRR FHDDITV+VV++DHEL++ + ++ ++ G +DS
Sbjct: 334 KGVRRFFHDDITVVVVYIDHELLQEKNVSVPELSVRGFVDS 374


>sp|Q10S32|P2C28_ORYSJ Probable protein phosphatase 2C 28 OS=Oryza
sativa subsp. japonica GN=Os03g0137200 PE=2 SV=1
Length = 399

Score = 43.1 bits (100), Expect = 8e-04
Identities = 19/19 (100%), Positives = 19/19 (100%)
Frame = -2

Query: 532 RGVRRHFHDDITVIVVFLD 476
RGVRRHFHDDITVIVVFLD
Sbjct: 339 RGVRRHFHDDITVIVVFLD 357


>sp|Q94H98|P2C34_ORYSJ Probable protein phosphatase 2C 34 OS=Oryza
sativa subsp. japonica GN=BIPP2C2 PE=2 SV=1
Length = 380

Score = 42.0 bits (97), Expect = 0.002
Identities = 24/48 (50%), Positives = 30/48 (62%), Gaps = 6/48 (12%)
Frame = -2

Query: 532 RGVRRHFHDDITVIVVFLDHELMRRGAAI-----NAV-APVGLLDSHS 407
+GVRRHFHDDI+VIVV+LD RR + N APV + S+S
Sbjct: 318 KGVRRHFHDDISVIVVYLDRHRGRRHTRVVDSSSNCTNAPVDIYSSNS 365


>sp|Q5MFV5|P2C34_ORYSI Probable protein phosphatase 2C 34 OS=Oryza
sativa subsp. indica GN=BIPP2C2 PE=2 SV=2
Length = 380

Score = 42.0 bits (97), Expect = 0.002
Identities = 24/48 (50%), Positives = 30/48 (62%), Gaps = 6/48 (12%)
Frame = -2

Query: 532 RGVRRHFHDDITVIVVFLDHELMRRGAAI-----NAV-APVGLLDSHS 407
+GVRRHFHDDI+VIVV+LD RR + N APV + S+S
Sbjct: 318 KGVRRHFHDDISVIVVYLDRHRGRRHTRVVDSSSNCTNAPVDIYSSNS 365


>sp|Q7XHN8|P2C61_ORYSJ Probable protein phosphatase 2C 61 OS=Oryza
sativa subsp. japonica GN=Os07g0114000 PE=2 SV=1
Length = 377

Score = 41.6 bits (96), Expect = 0.002
Identities = 20/37 (54%), Positives = 24/37 (64%), Gaps = 6/37 (16%)
Frame = -2

Query: 532 RGVRRHFHDDITVIVVFLD------HELMRRGAAINA 440
RGVRRHFHDDIT +VVFLD RRG +++
Sbjct: 321 RGVRRHFHDDITAVVVFLDLDDDGGRRARRRGRVVDS 357


>sp|Q7XCJ7|P2C72_ORYSJ Probable protein phosphatase 2C 72 OS=Oryza
sativa subsp. japonica GN=Os10g0544900 PE=2 SV=1
Length = 393

Score = 41.2 bits (95), Expect = 0.003
Identities = 17/19 (89%), Positives = 18/19 (94%)
Frame = -2

Query: 532 RGVRRHFHDDITVIVVFLD 476
RGVRRHFHDDITV+VVF D
Sbjct: 340 RGVRRHFHDDITVVVVFFD 358


>sp|Q2QN36|P2C78_ORYSJ Probable protein phosphatase 2C 78 OS=Oryza
sativa subsp. japonica GN=Os12g0580900 PE=2 SV=1
Length = 392

Score = 39.7 bits (91), Expect = 0.009
Identities = 16/20 (80%), Positives = 19/20 (95%)
Frame = -2

Query: 532 RGVRRHFHDDITVIVVFLDH 473
RG RR+FHDDITV+VV+LDH
Sbjct: 325 RGSRRNFHDDITVVVVYLDH 344


>sp|Q7Y138|P2C36_ORYSJ Probable protein phosphatase 2C 36 OS=Oryza
sativa subsp. japonica GN=Os03g0832400 PE=2 SV=1
Length = 386

Score = 39.3 bits (90), Expect = 0.012
Identities = 15/24 (62%), Positives = 22/24 (91%)
Frame = -2

Query: 526 VRRHFHDDITVIVVFLDHELMRRG 455
VRRHFHDDITVIV+F++++ + +G
Sbjct: 348 VRRHFHDDITVIVLFINYDQLAKG 371


tr_hit_id A9SV72
Definition tr|A9SV72|A9SV72_PHYPA Predicted protein OS=Physcomitrella patens subsp. patens
Align length 30
Score (bit) 51.6
E-value 2.0e-05
Report
BLASTX 2.2.19 [Nov-02-2008]


Reference: Altschul, Stephen F., Thomas L. Madden, Alejandro A. Schaffer,
Jinghui Zhang, Zheng Zhang, Webb Miller, and David J. Lipman (1997),
"Gapped BLAST and PSI-BLAST: a new generation of protein database search
programs", Nucleic Acids Res. 25:3389-3402.

Query= BP917818|Adiantum capillus-veneris mRNA, clone:
YMU001_000105_H01.
(533 letters)

Database: uniprot_trembl.fasta
7,341,751 sequences; 2,391,615,440 total letters

Searching..................................................done



Score E
Sequences producing significant alignments: (bits) Value

tr|A9SV72|A9SV72_PHYPA Predicted protein OS=Physcomitrella paten... 52 2e-05
tr|B8LQT5|B8LQT5_PICSI Putative uncharacterized protein OS=Picea... 51 4e-05
tr|A9TD47|A9TD47_PHYPA Predicted protein OS=Physcomitrella paten... 51 4e-05
tr|Q9ZSQ7|Q9ZSQ7_MESCR Protein phosphatase 2C homolog OS=Mesembr... 50 7e-05
tr|A7PVW6|A7PVW6_VITVI Chromosome chr8 scaffold_34, whole genome... 50 9e-05
tr|B7FLN0|B7FLN0_MEDTR Putative uncharacterized protein OS=Medic... 49 1e-04
tr|B7FJF3|B7FJF3_MEDTR Putative uncharacterized protein OS=Medic... 49 1e-04
tr|A5B0L3|A5B0L3_VITVI Putative uncharacterized protein OS=Vitis... 49 2e-04
tr|A9TNG1|A9TNG1_PHYPA Predicted protein OS=Physcomitrella paten... 49 2e-04
tr|Q9SZN2|Q9SZN2_ARATH Putative uncharacterized protein F20M13.8... 48 3e-04
tr|Q9M3V0|Q9M3V0_FAGSY Protein phosphatase 2C (PP2C) OS=Fagus sy... 48 3e-04
tr|Q8W4N8|Q8W4N8_ARATH Putative uncharacterized protein At4g3852... 48 3e-04
tr|Q5PNS9|Q5PNS9_ARATH At4g38520 OS=Arabidopsis thaliana PE=2 SV=1 48 3e-04
tr|A7P8E3|A7P8E3_VITVI Chromosome chr3 scaffold_8, whole genome ... 48 3e-04
tr|A5C806|A5C806_VITVI Putative uncharacterized protein OS=Vitis... 48 3e-04
tr|A9RIX5|A9RIX5_PHYPA Predicted protein OS=Physcomitrella paten... 47 5e-04
tr|A7Q409|A7Q409_VITVI Chromosome chr13 scaffold_48, whole genom... 47 5e-04
tr|B6SYG9|B6SYG9_MAIZE Protein phosphatase 2C OS=Zea mays PE=2 SV=1 47 6e-04
tr|B6SV58|B6SV58_MAIZE Protein phosphatase 2C OS=Zea mays PE=2 SV=1 47 6e-04
tr|Q9LSN8|Q9LSN8_ARATH Protein phosphatase 2C-like protein OS=Ar... 47 8e-04
tr|Q9LHJ9|Q9LHJ9_ARATH Protein phosphatase 2C (Putative uncharac... 47 8e-04
tr|Q9C7B3|Q9C7B3_ARATH Protein phosphatase 2C, putative; 16828-1... 47 8e-04
tr|Q8LEW2|Q8LEW2_ARATH Protein phosphatase-2c, putative OS=Arabi... 47 8e-04
tr|Q0V7V2|Q0V7V2_ARATH At3g17090 OS=Arabidopsis thaliana PE=2 SV=1 47 8e-04
tr|B8B2J1|B8B2J1_ORYSI Putative uncharacterized protein OS=Oryza... 47 8e-04
tr|A3BFG0|A3BFG0_ORYSJ Putative uncharacterized protein OS=Oryza... 47 8e-04
tr|A2XWU4|A2XWU4_ORYSI Putative uncharacterized protein OS=Oryza... 47 8e-04
tr|Q9FKX4|Q9FKX4_ARATH Protein phosphatase 2C-like protein OS=Ar... 46 0.001
tr|O82479|O82479_MESCR Protein phosphatase-2c (Fragment) OS=Mese... 46 0.001
tr|A7PSU5|A7PSU5_VITVI Chromosome chr8 scaffold_29, whole genome... 46 0.001

>tr|A9SV72|A9SV72_PHYPA Predicted protein OS=Physcomitrella patens
subsp. patens GN=PHYPADRAFT_107052 PE=4 SV=1
Length = 371

Score = 51.6 bits (122), Expect = 2e-05
Identities = 21/30 (70%), Positives = 26/30 (86%)
Frame = -2

Query: 532 RGVRRHFHDDITVIVVFLDHELMRRGAAIN 443
RG+RRHFHDDITV+VVFLDH L+ G+ I+
Sbjct: 329 RGIRRHFHDDITVVVVFLDHNLVSNGSGIS 358


>tr|B8LQT5|B8LQT5_PICSI Putative uncharacterized protein OS=Picea
sitchensis PE=2 SV=1
Length = 209

Score = 50.8 bits (120), Expect = 4e-05
Identities = 27/48 (56%), Positives = 33/48 (68%), Gaps = 4/48 (8%)
Frame = -2

Query: 532 RGVRRHFHDDITVIVVFLDHELM----RRGAAINAVAPVGLLDSHSVA 401
RGVRRHFHDDITVIVVFLDH L+ RG I+ + + S+S+A
Sbjct: 152 RGVRRHFHDDITVIVVFLDHSLISKFSSRGPTISIIGGGTTVPSNSLA 199


>tr|A9TD47|A9TD47_PHYPA Predicted protein OS=Physcomitrella patens
subsp. patens GN=PHYPADRAFT_193911 PE=4 SV=1
Length = 371

Score = 50.8 bits (120), Expect = 4e-05
Identities = 20/30 (66%), Positives = 26/30 (86%)
Frame = -2

Query: 532 RGVRRHFHDDITVIVVFLDHELMRRGAAIN 443
RG+RRHFHDDITV+VVFLDH L+ G++ +
Sbjct: 329 RGIRRHFHDDITVVVVFLDHNLLSNGSSFS 358


>tr|Q9ZSQ7|Q9ZSQ7_MESCR Protein phosphatase 2C homolog
OS=Mesembryanthemum crystallinum GN=PP2C PE=2 SV=1
Length = 396

Score = 50.1 bits (118), Expect = 7e-05
Identities = 21/29 (72%), Positives = 26/29 (89%)
Frame = -2

Query: 532 RGVRRHFHDDITVIVVFLDHELMRRGAAI 446
RGVRRHFHDDITV+VVFLD L+ RG+++
Sbjct: 337 RGVRRHFHDDITVVVVFLDSNLISRGSSV 365


>tr|A7PVW6|A7PVW6_VITVI Chromosome chr8 scaffold_34, whole genome
shotgun sequence OS=Vitis vinifera GN=GSVIVT00025384001
PE=4 SV=1
Length = 390

Score = 49.7 bits (117), Expect = 9e-05
Identities = 19/40 (47%), Positives = 32/40 (80%)
Frame = -2

Query: 532 RGVRRHFHDDITVIVVFLDHELMRRGAAINAVAPVGLLDS 413
+GVRR FHDDITV+V++LDHE++R+ ++ ++ G +D+
Sbjct: 333 KGVRRFFHDDITVVVIYLDHEVLRKNFSVPELSVRGFIDT 372


>tr|B7FLN0|B7FLN0_MEDTR Putative uncharacterized protein OS=Medicago
truncatula PE=2 SV=1
Length = 266

Score = 49.3 bits (116), Expect = 1e-04
Identities = 22/29 (75%), Positives = 24/29 (82%)
Frame = -2

Query: 532 RGVRRHFHDDITVIVVFLDHELMRRGAAI 446
RGVRRHFHDDITVIVVFLD LM R + +
Sbjct: 207 RGVRRHFHDDITVIVVFLDSNLMSRASTV 235


>tr|B7FJF3|B7FJF3_MEDTR Putative uncharacterized protein OS=Medicago
truncatula PE=2 SV=1
Length = 378

Score = 49.3 bits (116), Expect = 1e-04
Identities = 22/29 (75%), Positives = 24/29 (82%)
Frame = -2

Query: 532 RGVRRHFHDDITVIVVFLDHELMRRGAAI 446
RGVRRHFHDDITVIVVFLD LM R + +
Sbjct: 338 RGVRRHFHDDITVIVVFLDSNLMSRASTV 366


>tr|A5B0L3|A5B0L3_VITVI Putative uncharacterized protein OS=Vitis
vinifera GN=VITISV_040860 PE=4 SV=1
Length = 398

Score = 48.9 bits (115), Expect = 2e-04
Identities = 19/40 (47%), Positives = 31/40 (77%)
Frame = -2

Query: 532 RGVRRHFHDDITVIVVFLDHELMRRGAAINAVAPVGLLDS 413
+GVRR FHDDITV+V++LDHE +R+ ++ ++ G +D+
Sbjct: 333 KGVRRFFHDDITVVVIYLDHEXLRKNFSVPELSVRGFIDT 372


>tr|A9TNG1|A9TNG1_PHYPA Predicted protein OS=Physcomitrella patens
subsp. patens GN=PHYPADRAFT_110476 PE=4 SV=1
Length = 388

Score = 48.5 bits (114), Expect = 2e-04
Identities = 19/30 (63%), Positives = 27/30 (90%)
Frame = -2

Query: 532 RGVRRHFHDDITVIVVFLDHELMRRGAAIN 443
RG+RRHFHDDITV+V++LD +L+ RG +I+
Sbjct: 328 RGIRRHFHDDITVVVLYLDTKLLNRGGSIS 357


>tr|Q9SZN2|Q9SZN2_ARATH Putative uncharacterized protein F20M13.80
(Putative uncharacterized protein AT4g38520)
OS=Arabidopsis thaliana GN=F20M13.80 PE=2 SV=1
Length = 395

Score = 48.1 bits (113), Expect = 3e-04
Identities = 22/33 (66%), Positives = 25/33 (75%)
Frame = -2

Query: 532 RGVRRHFHDDITVIVVFLDHELMRRGAAINAVA 434
RGVRRHFHDDITVIVVF D L+ RG+ + A
Sbjct: 333 RGVRRHFHDDITVIVVFFDTNLVSRGSMLRGPA 365