BP917840
Clone id YMU001_000106_B10
Library
Length 325
Definition Adiantum capillus-veneris mRNA. clone: YMU001_000106_B10.
Accession
Tissue type prothallium
Developmental stage -
Contig ID -
Sequence
CCCTCGAAGAGATCACCAATCCCGAGTGACCCTTTGCTTGCAACCATGCATGTCTATGTT
CTCTCCCATGTCTTTCTTTGTCAAATAGCTATTAGAAGCCACATTGCTGATCACTCTCCA
TTTCACAGCTTACATCTGCTTTGATCGCTATCGTCCACTTAAATGCGTGCTAGAATCTAC
AGACTCCCATGATTGGCTTCCTGATGACGTTGGAAAAGAGTAAGCTGTAGAGTGCTTTGC
ATTTTCCTGTGCGCCCAAGTCTGCAATAGGTAGGGACGCACGATACATAAGAACTTGCAC
TGCTTGTTGCATAGAGGGCCTCCTT
■■Homology search results ■■ -
sp_hit_id P21133
Definition sp|P21133|AAAA_EMENI Acyl-coenzyme A:6-aminopenicillanic-acid-acyltransferase 40 kDa form OS=Emericella nidulans
Align length 27
Score (bit) 32.3
E-value 0.77
Report
BLASTX 2.2.19 [Nov-02-2008]


Reference: Altschul, Stephen F., Thomas L. Madden, Alejandro A. Schaffer,
Jinghui Zhang, Zheng Zhang, Webb Miller, and David J. Lipman (1997),
"Gapped BLAST and PSI-BLAST: a new generation of protein database search
programs", Nucleic Acids Res. 25:3389-3402.

Query= BP917840|Adiantum capillus-veneris mRNA, clone:
YMU001_000106_B10.
(325 letters)

Database: uniprot_sprot.fasta
412,525 sequences; 148,809,765 total letters

Searching..................................................done



Score E
Sequences producing significant alignments: (bits) Value

sp|P21133|AAAA_EMENI Acyl-coenzyme A:6-aminopenicillanic-acid-ac... 32 0.77
sp|Q7Z434|MAVS_HUMAN Mitochondrial antiviral-signaling protein O... 30 5.0

>sp|P21133|AAAA_EMENI Acyl-coenzyme
A:6-aminopenicillanic-acid-acyltransferase 40 kDa form
OS=Emericella nidulans GN=penDE PE=1 SV=1
Length = 357

Score = 32.3 bits (72), Expect = 0.77
Identities = 15/27 (55%), Positives = 18/27 (66%)
Frame = +1

Query: 241 IFLCAQVCNR*GRTIHKNLHCLLHRGP 321
I LC QV + GR +H N HCLL+ GP
Sbjct: 229 ISLCKQVADTNGRIVHTN-HCLLNHGP 254


>sp|Q7Z434|MAVS_HUMAN Mitochondrial antiviral-signaling protein
OS=Homo sapiens GN=MAVS PE=1 SV=2
Length = 540

Score = 29.6 bits (65), Expect = 5.0
Identities = 20/52 (38%), Positives = 27/52 (51%)
Frame = -2

Query: 309 QQAVQVLMYRASLPIADLGAQENAKHSTAYSFPTSSGSQSWESVDSSTHLSG 154
+QA+Q L RA D G E++ A S TSSG Q ++ STH +G
Sbjct: 158 EQALQTLSPRAIPRNPDGGPLESSSDLAALSPLTSSGHQEQDTELGSTHTAG 209


tr_hit_id -
Definition No hits.
Align length -
Score (bit) -
E-value -
Report
BLASTX 2.2.19 [Nov-02-2008]


Reference: Altschul, Stephen F., Thomas L. Madden, Alejandro A. Schaffer,
Jinghui Zhang, Zheng Zhang, Webb Miller, and David J. Lipman (1997),
"Gapped BLAST and PSI-BLAST: a new generation of protein database search
programs", Nucleic Acids Res. 25:3389-3402.

Query= BP917840|Adiantum capillus-veneris mRNA, clone:
YMU001_000106_B10.
(325 letters)

Database: uniprot_trembl.fasta
7,341,751 sequences; 2,391,615,440 total letters

Searching..................................................done

***** No hits found ******