BP917859
Clone id YMU001_000106_E01
Library
Length 189
Definition Adiantum capillus-veneris mRNA. clone: YMU001_000106_E01.
Accession
Tissue type prothallium
Developmental stage -
Contig ID
Sequence
ATCTGCTATGCTATCCTCCAGCAGAACCTGGGTAGGCTTTAACTGTCTGCTATATATGCT
GCAGGTAGCTCCCATAGCCCCTTATGAGCTTGCATGCACAAGTGACAATCTTGACATCAA
GCTGGGGTAAAACTTCATGCATGGCAGTTCCTCACTAGGAAGATAGACTCTGAGTTTGTC
ATCCTTTCT
■■Homology search results ■■ -
sp_hit_id O74742
Definition sp|O74742|FOLE_SCHPO Probable folylpolyglutamate synthase OS=Schizosaccharomyces pombe
Align length 47
Score (bit) 31.2
E-value 1.7
Report
BLASTX 2.2.19 [Nov-02-2008]


Reference: Altschul, Stephen F., Thomas L. Madden, Alejandro A. Schaffer,
Jinghui Zhang, Zheng Zhang, Webb Miller, and David J. Lipman (1997),
"Gapped BLAST and PSI-BLAST: a new generation of protein database search
programs", Nucleic Acids Res. 25:3389-3402.

Query= BP917859|Adiantum capillus-veneris mRNA, clone:
YMU001_000106_E01.
(189 letters)

Database: uniprot_sprot.fasta
412,525 sequences; 148,809,765 total letters

Searching..................................................done



Score E
Sequences producing significant alignments: (bits) Value

sp|O74742|FOLE_SCHPO Probable folylpolyglutamate synthase OS=Sch... 31 1.7

>sp|O74742|FOLE_SCHPO Probable folylpolyglutamate synthase
OS=Schizosaccharomyces pombe GN=SPBC1709.17 PE=2 SV=1
Length = 505

Score = 31.2 bits (69), Expect = 1.7
Identities = 16/47 (34%), Positives = 27/47 (57%)
Frame = -1

Query: 147 LPCMKFYPSLMSRLSLVHASS*GAMGATCSIYSRQLKPTQVLLEDSI 7
L C+ + PS ++RL+++H + G+TC+ S L+ Q E SI
Sbjct: 66 LRCIGYQPSDLNRLNVIHVAGTKGKGSTCAFTSSILQQIQKSGERSI 112


tr_hit_id B7AKL8
Definition tr|B7AKL8|B7AKL8_9BACE Putative uncharacterized protein OS=Bacteroides eggerthii DSM 20697
Align length 65
Score (bit) 33.9
E-value 4.2
Report
BLASTX 2.2.19 [Nov-02-2008]


Reference: Altschul, Stephen F., Thomas L. Madden, Alejandro A. Schaffer,
Jinghui Zhang, Zheng Zhang, Webb Miller, and David J. Lipman (1997),
"Gapped BLAST and PSI-BLAST: a new generation of protein database search
programs", Nucleic Acids Res. 25:3389-3402.

Query= BP917859|Adiantum capillus-veneris mRNA, clone:
YMU001_000106_E01.
(189 letters)

Database: uniprot_trembl.fasta
7,341,751 sequences; 2,391,615,440 total letters

Searching..................................................done



Score E
Sequences producing significant alignments: (bits) Value

tr|B7AKL8|B7AKL8_9BACE Putative uncharacterized protein OS=Bacte... 34 4.2
tr|B0NTG5|B0NTG5_BACSE Putative uncharacterized protein OS=Bacte... 34 4.2

>tr|B7AKL8|B7AKL8_9BACE Putative uncharacterized protein
OS=Bacteroides eggerthii DSM 20697 GN=BACEGG_02978 PE=4
SV=1
Length = 820

Score = 33.9 bits (76), Expect = 4.2
Identities = 19/65 (29%), Positives = 29/65 (44%), Gaps = 9/65 (13%)
Frame = -2

Query: 188 ERMTNSESIFLVRN---------CHA*SFTPA*CQDCHLCMQAHKGLWELPAAYIADS*S 36
E + E + L +N CH + P C++C + + HKGL +L Y +
Sbjct: 504 EALEQKEQVILFQNRRGFAPMIECHTCGWVPK-CKNCDVSLTYHKGLNQLTCHYCGYTYQ 562

Query: 35 LPRFC 21
LPR C
Sbjct: 563 LPRIC 567


>tr|B0NTG5|B0NTG5_BACSE Putative uncharacterized protein
OS=Bacteroides stercoris ATCC 43183 GN=BACSTE_02786 PE=4
SV=1
Length = 820

Score = 33.9 bits (76), Expect = 4.2
Identities = 19/65 (29%), Positives = 29/65 (44%), Gaps = 9/65 (13%)
Frame = -2

Query: 188 ERMTNSESIFLVRN---------CHA*SFTPA*CQDCHLCMQAHKGLWELPAAYIADS*S 36
E + E + L +N CH + P C++C + + HKGL +L Y +
Sbjct: 504 EALERKEQVILFQNRRGFAPMIECHTCGWVPK-CKNCDVSLTYHKGLNQLTCHYCGYTYQ 562

Query: 35 LPRFC 21
LPR C
Sbjct: 563 LPRIC 567