BP917865
Clone id YMU001_000106_E08
Library
Length 253
Definition Adiantum capillus-veneris mRNA. clone: YMU001_000106_E08.
Accession
Tissue type prothallium
Developmental stage -
Contig ID
Sequence
TTATACTTCGAAAATCCCTGTATTTCTTCTTTATCTTGTGATGAAGCCTCAGCAGAGGGA
CAATGCATGGAATGCCATCCATGAAAAACTCTGCATTTTGATATGGCTTCTCACTGTAAA
AACACACTCCAGAGTTCCCATGTCGCGACCATCAAAGCTGGGTGTCACTGTGAAGTTGAG
TAGCGCAATACAGATTGCATTCAAGGCCAGATCCTGCAGAGCCAATAGCATCACTTGCTT
GGCTTAATCCTCC
■■Homology search results ■■ -
sp_hit_id Q8BJ48
Definition sp|Q8BJ48|NAGPA_MOUSE N-acetylglucosamine-1-phosphodiester alpha-N-acetylglucosaminidase OS=Mus musculus
Align length 67
Score (bit) 29.3
E-value 6.3
Report
BLASTX 2.2.19 [Nov-02-2008]


Reference: Altschul, Stephen F., Thomas L. Madden, Alejandro A. Schaffer,
Jinghui Zhang, Zheng Zhang, Webb Miller, and David J. Lipman (1997),
"Gapped BLAST and PSI-BLAST: a new generation of protein database search
programs", Nucleic Acids Res. 25:3389-3402.

Query= BP917865|Adiantum capillus-veneris mRNA, clone:
YMU001_000106_E08.
(253 letters)

Database: uniprot_sprot.fasta
412,525 sequences; 148,809,765 total letters

Searching..................................................done



Score E
Sequences producing significant alignments: (bits) Value

sp|Q8BJ48|NAGPA_MOUSE N-acetylglucosamine-1-phosphodiester alpha... 29 6.3
sp|Q9BXP8|PAPP2_HUMAN Pappalysin-2 OS=Homo sapiens GN=PAPPA2 PE=... 29 8.3

>sp|Q8BJ48|NAGPA_MOUSE N-acetylglucosamine-1-phosphodiester
alpha-N-acetylglucosaminidase OS=Mus musculus GN=Nagpa
PE=2 SV=2
Length = 517

Score = 29.3 bits (64), Expect = 6.3
Identities = 17/67 (25%), Positives = 26/67 (38%), Gaps = 7/67 (10%)
Frame = +1

Query: 19 CISSLSCD--EASAEGQCMECHP*KTLHFDMASHCKN-----TLQSSHVATIKAGCHCEV 177
C+ C + S G C++ H T HF C + S H + GCHC+
Sbjct: 324 CVHEPRCQPPDCSGHGTCVDGHCECTSHFWRGEACSELDCGPSNCSQHGLCTETGCHCDA 383

Query: 178 E*RNTDC 198
++C
Sbjct: 384 GWTGSNC 390


>sp|Q9BXP8|PAPP2_HUMAN Pappalysin-2 OS=Homo sapiens GN=PAPPA2 PE=1
SV=4
Length = 1791

Score = 28.9 bits (63), Expect = 8.3
Identities = 14/44 (31%), Positives = 19/44 (43%)
Frame = +1

Query: 34 SCDEASAEGQCMECHP*KTLHFDMASHCKNTLQSSHVATIKAGC 165
SC+ A+G C + H+D C +TL S V A C
Sbjct: 1732 SCEPFQADGWCDTINNRAYCHYDGGDCCSSTLSSKKVIPFAADC 1775


tr_hit_id -
Definition No hits.
Align length -
Score (bit) -
E-value -
Report
BLASTX 2.2.19 [Nov-02-2008]


Reference: Altschul, Stephen F., Thomas L. Madden, Alejandro A. Schaffer,
Jinghui Zhang, Zheng Zhang, Webb Miller, and David J. Lipman (1997),
"Gapped BLAST and PSI-BLAST: a new generation of protein database search
programs", Nucleic Acids Res. 25:3389-3402.

Query= BP917865|Adiantum capillus-veneris mRNA, clone:
YMU001_000106_E08.
(253 letters)

Database: uniprot_trembl.fasta
7,341,751 sequences; 2,391,615,440 total letters

Searching..................................................done

***** No hits found ******