BP917869
Clone id YMU001_000106_E12
Library
Length 489
Definition Adiantum capillus-veneris mRNA. clone: YMU001_000106_E12.
Accession
Tissue type prothallium
Developmental stage -
Contig ID
Sequence
GGAGGAATACATGCCCACTTACGATCCCTTTAGCACATGCTTACTTGCAAGGCAGCACTG
CAGTGCGCAAAACTCTATACATAGCAAGGCTCCAGCACCAAGTTAGAAGACACACTTGAA
AAAAAAAGATCGTACTCCACCCTAAATATAGTAGGCGTTCAACATGTTAAACATTGGCCT
CTAATTAGAGATTGCGGCGTTGATTACACAGCCTGATTAAGAATTGGGTCAGACAGAACA
AGCTCACGCAGCGTTGGTGCAGCTTGATTAAGAATCGGGCCAGACAAAAGAAGCTCATGC
AAAAGCTGAACCCATTGATTGAGCTCACAAGCCGCTGAGGGCTTTCTGGGCAAAACTTCG
AGCAAAGCGAACCGTAGCTGGACGTCAGCCCTTGAAGCATTAAAAACAAAAACGACATCA
GCTTTTTGAAGATAATATAAGCAGCTATCTTAGGCGTAGACATCTTTTTCCTTCCTTGCG
CTCAGACAT
■■Homology search results ■■ -
sp_hit_id O59813
Definition sp|O59813|YCT3_SCHPO Uncharacterized amino-acid permease C794.03 OS=Schizosaccharomyces pombe
Align length 41
Score (bit) 31.6
E-value 2.0
Report
BLASTX 2.2.19 [Nov-02-2008]


Reference: Altschul, Stephen F., Thomas L. Madden, Alejandro A. Schaffer,
Jinghui Zhang, Zheng Zhang, Webb Miller, and David J. Lipman (1997),
"Gapped BLAST and PSI-BLAST: a new generation of protein database search
programs", Nucleic Acids Res. 25:3389-3402.

Query= BP917869|Adiantum capillus-veneris mRNA, clone:
YMU001_000106_E12.
(489 letters)

Database: uniprot_sprot.fasta
412,525 sequences; 148,809,765 total letters

Searching..................................................done



Score E
Sequences producing significant alignments: (bits) Value

sp|O59813|YCT3_SCHPO Uncharacterized amino-acid permease C794.03... 32 2.0

>sp|O59813|YCT3_SCHPO Uncharacterized amino-acid permease C794.03
OS=Schizosaccharomyces pombe GN=SPCC794.03 PE=2 SV=1
Length = 554

Score = 31.6 bits (70), Expect = 2.0
Identities = 14/41 (34%), Positives = 23/41 (56%)
Frame = -3

Query: 388 LTSSYGSLCSKFCPESPQRLVSSINGFSFCMSFFCLARFLI 266
+++ YG F + L NG+S+C++FFC AR L+
Sbjct: 226 VSTKYGFRDEAFMKSTNYDLGKVNNGWSWCLTFFCTARILV 266


tr_hit_id Q9RJ55
Definition tr|Q9RJ55|Q9RJ55_STRCO Putative uncharacterized protein SCO1653 OS=Streptomyces coelicolor
Align length 46
Score (bit) 34.3
E-value 3.2
Report
BLASTX 2.2.19 [Nov-02-2008]


Reference: Altschul, Stephen F., Thomas L. Madden, Alejandro A. Schaffer,
Jinghui Zhang, Zheng Zhang, Webb Miller, and David J. Lipman (1997),
"Gapped BLAST and PSI-BLAST: a new generation of protein database search
programs", Nucleic Acids Res. 25:3389-3402.

Query= BP917869|Adiantum capillus-veneris mRNA, clone:
YMU001_000106_E12.
(489 letters)

Database: uniprot_trembl.fasta
7,341,751 sequences; 2,391,615,440 total letters

Searching..................................................done



Score E
Sequences producing significant alignments: (bits) Value

tr|Q9RJ55|Q9RJ55_STRCO Putative uncharacterized protein SCO1653 ... 34 3.2
tr|B2GAT6|B2GAT6_LACF3 Putative uncharacterized protein OS=Lacto... 33 7.2

>tr|Q9RJ55|Q9RJ55_STRCO Putative uncharacterized protein SCO1653
OS=Streptomyces coelicolor GN=SCO1653 PE=4 SV=1
Length = 284

Score = 34.3 bits (77), Expect = 3.2
Identities = 18/46 (39%), Positives = 23/46 (50%)
Frame = -2

Query: 374 RFALLEVLPRKPSAACELNQWVQLLHELLLSGPILNQAAPTLRELV 237
RF +++ LP KPS A V + E L P + APT R LV
Sbjct: 24 RFRVIDRLPEKPSEAATRGTLVHAVLERLFDAPAAERTAPTARALV 69


>tr|B2GAT6|B2GAT6_LACF3 Putative uncharacterized protein
OS=Lactobacillus fermentum (strain IFO 3956 / LMG 18251)
GN=LAF_0432 PE=4 SV=1
Length = 381

Score = 33.1 bits (74), Expect = 7.2
Identities = 23/52 (44%), Positives = 29/52 (55%), Gaps = 3/52 (5%)
Frame = -3

Query: 199 RRNL*LEANV*HVER---LLYLGWSTIFFFQVCLLTWCWSLAMYRVLRTAVL 53
+RN L ANV +R L++LGW IF V ++ W SLAM V AVL
Sbjct: 120 KRNGHLTANVAGYKRDVVLVFLGWLVIFLL-VLMMGWAGSLAMLSVCLNAVL 170