BP917922
Clone id YMU001_000107_D04
Library
Length 507
Definition Adiantum capillus-veneris mRNA. clone: YMU001_000107_D04.
Accession
Tissue type prothallium
Developmental stage -
Contig ID -
Sequence
GAAGCAGGCAACGGGCCATTAGAAATGAAAGCATCGCAGAGAATGTACAAATACATTATG
AAAGTGAAGAAGATGTCTCCCAATAGAATACCACAAGTGGCATGGGGAGTCGGTTGTGCA
CCACAAAAAACAAACAAGAGTAAAATCTTCTCCTCAAGTCTGGTACAAGACATCAAGAGA
TGGTTTGCAAGATGGAATGTGGAAGCATATGTAGACATGCCTATCGAAGAAGGAAAAGAA
GGAGATTATATGCTGAATTTTGAGCTGACTGCGCTAGACAATCTCCACAACAAATGGAAG
ACGGCTACACACAGATCTAAATTTGAATACTACTGCAAACATGTACACACAAAGTATTGG
GAGGCATACAAAATGTCAGAAACACAAGTTCACATAAGAACTCCTATGTGTCACCGAGCA
AGAAGGGCCATCACTAGGATGCGTATGAGAGCTCACACGCTGAAAGTAGAGACAGGAGGA
TGGTTGAAAATTGATGCAAGCCAAAGA
■■Homology search results ■■ -
sp_hit_id -
Definition No hits.
Align length -
Score (bit) -
E-value -
Report
BLASTX 2.2.19 [Nov-02-2008]


Reference: Altschul, Stephen F., Thomas L. Madden, Alejandro A. Schaffer,
Jinghui Zhang, Zheng Zhang, Webb Miller, and David J. Lipman (1997),
"Gapped BLAST and PSI-BLAST: a new generation of protein database search
programs", Nucleic Acids Res. 25:3389-3402.

Query= BP917922|Adiantum capillus-veneris mRNA, clone:
YMU001_000107_D04.
(507 letters)

Database: uniprot_sprot.fasta
412,525 sequences; 148,809,765 total letters

Searching..................................................done

***** No hits found ******


tr_hit_id B1X2T7
Definition tr|B1X2T7|B1X2T7_CYAA5 Putative uncharacterized protein OS=Cyanothece (strain ATCC 51142)
Align length 64
Score (bit) 28.9
E-value 2.7
Report
BLASTX 2.2.19 [Nov-02-2008]


Reference: Altschul, Stephen F., Thomas L. Madden, Alejandro A. Schaffer,
Jinghui Zhang, Zheng Zhang, Webb Miller, and David J. Lipman (1997),
"Gapped BLAST and PSI-BLAST: a new generation of protein database search
programs", Nucleic Acids Res. 25:3389-3402.

Query= BP917922|Adiantum capillus-veneris mRNA, clone:
YMU001_000107_D04.
(507 letters)

Database: uniprot_trembl.fasta
7,341,751 sequences; 2,391,615,440 total letters

Searching..................................................done



Score E
Sequences producing significant alignments: (bits) Value

tr|B1X2T7|B1X2T7_CYAA5 Putative uncharacterized protein OS=Cyano... 29 2.7
tr|Q7XUN4|Q7XUN4_ORYSJ OSJNBa0064M23.1 protein (OSJNBa0011J08.22... 34 3.6
tr|Q7XPJ2|Q7XPJ2_ORYSJ OSJNBa0087O24.18 protein OS=Oryza sativa ... 34 4.7
tr|Q2YA36|Q2YA36_NITMU Hydroxylamine oxidase OS=Nitrosospira mul... 33 6.1
tr|Q8G9H3|Q8G9H3_9PROT Hydroxylamine oxidoreductase (Fragment) O... 33 6.1
tr|Q2R6I2|Q2R6I2_ORYSJ Retrotransposon protein, putative, Ty3-gy... 33 6.1
tr|Q7XWQ1|Q7XWQ1_ORYSJ OSJNBa0072D08.10 protein OS=Oryza sativa ... 33 8.0
tr|Q6AVJ6|Q6AVJ6_ORYSJ Putative retrotransposon protein (Transpo... 33 8.0

>tr|B1X2T7|B1X2T7_CYAA5 Putative uncharacterized protein
OS=Cyanothece (strain ATCC 51142) GN=cce_5102 PE=4 SV=1
Length = 273

Score = 28.9 bits (63), Expect(2) = 2.7
Identities = 19/64 (29%), Positives = 31/64 (48%)
Frame = +1

Query: 19 LEMKASQRMYKYIMKVKKMSPNRIPQVAWGVGCAPQKTNKSKIFSSSLVQDIKRWFARWN 198
LE+KA + +Y I + RIP++ K + ++ FSS ++ + W R N
Sbjct: 82 LEIKADEEIYHKIGVTTRDLEQRIPEI---------KRDLAQYFSSVSIKGLGFWPHRGN 132

Query: 199 VEAY 210
VE Y
Sbjct: 133 VEYY 136



Score = 24.6 bits (52), Expect(2) = 2.7
Identities = 9/16 (56%), Positives = 10/16 (62%)
Frame = +1

Query: 310 HRSKFEYYCKHVHTKY 357
HR EYY KH + KY
Sbjct: 129 HRGNVEYYFKHRYRKY 144


>tr|Q7XUN4|Q7XUN4_ORYSJ OSJNBa0064M23.1 protein (OSJNBa0011J08.22
protein) OS=Oryza sativa subsp. japonica
GN=OSJNBa0064M23.1 PE=4 SV=2
Length = 586

Score = 34.3 bits (77), Expect = 3.6
Identities = 23/89 (25%), Positives = 34/89 (38%), Gaps = 4/89 (4%)
Frame = +1

Query: 1 EAGNGPLEMKASQRMYKYIMKVKKMSPNRIPQVAWGVGCAPQKTNKSK----IFSSSLVQ 168
E NG ++ R+Y +M K +P V W V P +NK ++ S +
Sbjct: 404 EKANGIVQQGIKTRVYDRLMSHDKKWVEEVPSVLWAVRTTPTTSNKETPFFLVYGSEAML 463

Query: 169 DIKRWFARWNVEAYVDMPIEEGKEGDYML 255
K V+ Y D EE + D L
Sbjct: 464 PTKLRHQSTQVQKYSDEDQEEQRNDDVNL 492


>tr|Q7XPJ2|Q7XPJ2_ORYSJ OSJNBa0087O24.18 protein OS=Oryza sativa
subsp. japonica GN=OSJNBa0087O24.18 PE=4 SV=1
Length = 1512

Score = 33.9 bits (76), Expect = 4.7
Identities = 32/132 (24%), Positives = 50/132 (37%), Gaps = 6/132 (4%)
Frame = +1

Query: 1 EAGNGPLEMKASQRMYKYIMKVKKMSPNRIPQVAWGVGCAPQKTNKSKIF------SSSL 162
E NG + R+Y +M K IP V W V P +NK F + L
Sbjct: 1330 ERENGIVLQGLKTRVYDRLMSHDKKWVEEIPSVLWAVRTTPTTSNKETRFFLMYGSEAML 1389

Query: 163 VQDIKRWFARWNVEAYVDMPIEEGKEGDYMLNFELTALDNLHNKWKTATHRSKFEYYCKH 342
+++ R V Y D EE + D L E ++ + A + +++ +H
Sbjct: 1390 PTELRHQSTR--VHKYSDEDQEEQRNDDVNLLEE--------HRERVAIRAASYQHALRH 1439

Query: 343 VHTKYWEAYKMS 378
H K A +S
Sbjct: 1440 YHEKRIRARTLS 1451


>tr|Q2YA36|Q2YA36_NITMU Hydroxylamine oxidase OS=Nitrosospira
multiformis (strain ATCC 25196 / NCIMB 11849)
GN=Nmul_A0805 PE=3 SV=1
Length = 570

Score = 33.5 bits (75), Expect = 6.1
Identities = 20/71 (28%), Positives = 29/71 (40%), Gaps = 4/71 (5%)
Frame = +1

Query: 181 WFARWNVEAYVDMPIEEGKEGDYMLNFELTALDNLHNKWKTATHRSKFEYYCKHVHT--- 351
W A V + MP E EG M + D+ H + + + S+ C H+
Sbjct: 231 WKANVEVAVFASMPQREIAEGCSMCHTNQNKCDSCHTRHEFSAAESRHPEACATCHSGVD 290

Query: 352 -KYWEAYKMSE 381
WEAY MS+
Sbjct: 291 HNNWEAYSMSK 301


>tr|Q8G9H3|Q8G9H3_9PROT Hydroxylamine oxidoreductase (Fragment)
OS=Nitrosospira multiformis GN=hao PE=4 SV=1
Length = 343

Score = 33.5 bits (75), Expect = 6.1
Identities = 20/71 (28%), Positives = 29/71 (40%), Gaps = 4/71 (5%)
Frame = +1

Query: 181 WFARWNVEAYVDMPIEEGKEGDYMLNFELTALDNLHNKWKTATHRSKFEYYCKHVHT--- 351
W A V + MP E EG M + D+ H + + + S+ C H+
Sbjct: 124 WKANVEVAVFASMPQREIAEGCSMCHTNQNKCDSCHTRHEFSAAESRHPEACATCHSGVD 183

Query: 352 -KYWEAYKMSE 381
WEAY MS+
Sbjct: 184 HNNWEAYSMSK 194


>tr|Q2R6I2|Q2R6I2_ORYSJ Retrotransposon protein, putative, Ty3-gypsy
subclass OS=Oryza sativa subsp. japonica
GN=LOC_Os11g19960 PE=4 SV=1
Length = 1280

Score = 33.5 bits (75), Expect = 6.1
Identities = 28/130 (21%), Positives = 48/130 (36%), Gaps = 4/130 (3%)
Frame = +1

Query: 1 EAGNGPLEMKASQRMYKYIMKVKKMSPNRIPQVAWGVGCAPQKTNKSK----IFSSSLVQ 168
E NG + R+Y +M K +P V W + P +NK ++ S +
Sbjct: 1138 ERANGIVLQGFKTRVYDRLMSHDKKWVEELPSVLWAIRTTPTTSNKETPLFLVYGSEAML 1197

Query: 169 DIKRWFARWNVEAYVDMPIEEGKEGDYMLNFELTALDNLHNKWKTATHRSKFEYYCKHVH 348
K V+ Y D EE + D L E ++ + A + ++ + H
Sbjct: 1198 PTKLRHQGTRVQKYSDEDQEEQRSDDVHLLVE--------HRERVAVKAASYQQALRRYH 1249

Query: 349 TKYWEAYKMS 378
K A+ +S
Sbjct: 1250 EKRIRAHTLS 1259


>tr|Q7XWQ1|Q7XWQ1_ORYSJ OSJNBa0072D08.10 protein OS=Oryza sativa
subsp. japonica GN=OSJNBa0072D08.10 PE=4 SV=2
Length = 694

Score = 33.1 bits (74), Expect = 8.0
Identities = 31/136 (22%), Positives = 48/136 (35%), Gaps = 16/136 (11%)
Frame = +1

Query: 1 EAGNGPLEMKASQRMYKYIMKVKKMSPNRIPQVAWGVGCAPQKTNKSK----IFSSSLVQ 168
E NG + R+Y +M + +P V W V P +NK ++ S +
Sbjct: 512 ERANGIVLQGIKTRVYDKLMSHDRKWVEELPSVLWAVRTTPTTSNKETPFFLVYGSEAML 571

Query: 169 DIKRWFARWNVEAYVDMPIEEGKEGDYMLNFE------------LTALDNLHNKWKTATH 312
+ V+ Y D EE + D L E AL H K A
Sbjct: 572 PTELRHQSTRVQKYSDEDQEEQRNDDVNLLEEHRERVVVRAASYQQALRRYHEKRIRART 631

Query: 313 RSKFEYYCKHVHTKYW 360
S +Y+ + V ++ W
Sbjct: 632 LSISDYFLRRVQSQAW 647


>tr|Q6AVJ6|Q6AVJ6_ORYSJ Putative retrotransposon protein (Transposon
protein, putative, unclassified) OS=Oryza sativa subsp.
japonica GN=OSJNBa0022C08.11 PE=4 SV=1
Length = 564

Score = 33.1 bits (74), Expect = 8.0
Identities = 29/130 (22%), Positives = 48/130 (36%), Gaps = 4/130 (3%)
Frame = +1

Query: 1 EAGNGPLEMKASQRMYKYIMKVKKMSPNRIPQVAWGVGCAPQKTNKSK----IFSSSLVQ 168
E NG + R+Y +M K +P V W V P +NK ++ S +
Sbjct: 411 ERANGIVLQGIKTRVYDRLMSHDKKWVEELPLVLWAVRTTPTTSNKETPFFLVYGSEAML 470

Query: 169 DIKRWFARWNVEAYVDMPIEEGKEGDYMLNFELTALDNLHNKWKTATHRSKFEYYCKHVH 348
+ + V+ Y D EE D L E + + A + ++ +H H
Sbjct: 471 PSELRYQSTRVQKYSDEDQEEQGNDDVNLLEEY--------RERVAVRAASYQQALRHYH 522

Query: 349 TKYWEAYKMS 378
K+ A +S
Sbjct: 523 EKHIRARILS 532