BP917925
Clone id YMU001_000107_D07
Library
Length 175
Definition Adiantum capillus-veneris mRNA. clone: YMU001_000107_D07.
Accession
Tissue type prothallium
Developmental stage -
Contig ID -
Sequence
AAGAGTAGATCCCTCCGGGAAGTCCTTTCGAGCTCCTTCAACAGATCGTAATGGTGCTTA
CATGGTATAATTGTGTGTATTCACAGAACCATACAAGCTCGTTAGAAAATGAGTTAGGAC
AACGCATAGGGAGATCTGAGTGCAGAGAGAAGTACGGGGGGGTGCAATGTCTTAA
■■Homology search results ■■ -
sp_hit_id Q5U623
Definition sp|Q5U623|MCAF2_HUMAN Activating transcription factor 7-interacting protein 2 OS=Homo sapiens
Align length 18
Score (bit) 29.6
E-value 4.9
Report
BLASTX 2.2.19 [Nov-02-2008]


Reference: Altschul, Stephen F., Thomas L. Madden, Alejandro A. Schaffer,
Jinghui Zhang, Zheng Zhang, Webb Miller, and David J. Lipman (1997),
"Gapped BLAST and PSI-BLAST: a new generation of protein database search
programs", Nucleic Acids Res. 25:3389-3402.

Query= BP917925|Adiantum capillus-veneris mRNA, clone:
YMU001_000107_D07.
(175 letters)

Database: uniprot_sprot.fasta
412,525 sequences; 148,809,765 total letters

Searching..................................................done



Score E
Sequences producing significant alignments: (bits) Value

sp|Q5U623|MCAF2_HUMAN Activating transcription factor 7-interact... 30 4.9

>sp|Q5U623|MCAF2_HUMAN Activating transcription factor 7-interacting
protein 2 OS=Homo sapiens GN=ATF7IP2 PE=2 SV=2
Length = 682

Score = 29.6 bits (65), Expect = 4.9
Identities = 11/18 (61%), Positives = 15/18 (83%)
Frame = +3

Query: 111 ELGQRIGRSECREKYGGV 164
EL QRIG++ECR K+ G+
Sbjct: 343 ELNQRIGKTECRNKHEGI 360


tr_hit_id A6FIS1
Definition tr|A6FIS1|A6FIS1_9GAMM Probable 2-isopropylmalate synthase OS=Moritella sp. PE36
Align length 46
Score (bit) 33.1
E-value 7.0
Report
BLASTX 2.2.19 [Nov-02-2008]


Reference: Altschul, Stephen F., Thomas L. Madden, Alejandro A. Schaffer,
Jinghui Zhang, Zheng Zhang, Webb Miller, and David J. Lipman (1997),
"Gapped BLAST and PSI-BLAST: a new generation of protein database search
programs", Nucleic Acids Res. 25:3389-3402.

Query= BP917925|Adiantum capillus-veneris mRNA, clone:
YMU001_000107_D07.
(175 letters)

Database: uniprot_trembl.fasta
7,341,751 sequences; 2,391,615,440 total letters

Searching..................................................done



Score E
Sequences producing significant alignments: (bits) Value

tr|A6FIS1|A6FIS1_9GAMM Probable 2-isopropylmalate synthase OS=Mo... 33 7.0

>tr|A6FIS1|A6FIS1_9GAMM Probable 2-isopropylmalate synthase
OS=Moritella sp. PE36 GN=PE36_15597 PE=3 SV=1
Length = 540

Score = 33.1 bits (74), Expect = 7.0
Identities = 13/46 (28%), Positives = 26/46 (56%)
Frame = -1

Query: 160 PPYFSLHSDLPMRCPNSFSNELVWFCEYTQLYHVSTITIC*RSSKG 23
P +L + + M PN F++++ WFCE+ Q T+++ + +G
Sbjct: 189 PVIINLPATVEMSTPNVFADQVEWFCEHVQNRDAITVSVHTHNDRG 234