BP917935
Clone id YMU001_000107_E08
Library
Length 500
Definition Adiantum capillus-veneris mRNA. clone: YMU001_000107_E08.
Accession
Tissue type prothallium
Developmental stage -
Contig ID -
Sequence
AGAAGAAATCTCCCAGAGAATCCCATTCTGCCAGAATCTACTCCTGCGCCCGTCCCGAAT
CCATTCGAGTTCCGGAAATTCCCGCAGACATTCCCAGAACCTGTTCCCGAACCGGAATCT
ACATCTATTCAAGAGTTCCTTTTGAGGCGTAACCATGCCAAATTCTCAGGACGGAGGTGG
TCAATCTGACGATGCCCTTACGCTTATCAAGGAGCAAATGGCCACACTTTCCATAAGCCT
CGCATCACTTCACACTCGCTTGGATGAGATGCACATAGAAAACACTTCTCGAAGTCGACC
TACTGTTTCTCGAACTACTAATGCAGCATCTTCAACACATTCTTCCGAAGCTTCAGTGGA
CAAACCAAACGAACCAGATCCAACTGAAGAGATAGACAATCGCGAACTTCAATTACTTTA
TAAAATTTTTAATGCTGCACAAAAGAAGAAGCTTGATGTTAAACTGCCGGAACCGTATAA
TGGTCGCCGCGACAAGCGCG
■■Homology search results ■■ -
sp_hit_id A5DVD6
Definition sp|A5DVD6|PAN1_LODEL Actin cytoskeleton-regulatory complex protein PAN1 OS=Lodderomyces elongisporus
Align length 39
Score (bit) 35.4
E-value 0.15
Report
BLASTX 2.2.19 [Nov-02-2008]


Reference: Altschul, Stephen F., Thomas L. Madden, Alejandro A. Schaffer,
Jinghui Zhang, Zheng Zhang, Webb Miller, and David J. Lipman (1997),
"Gapped BLAST and PSI-BLAST: a new generation of protein database search
programs", Nucleic Acids Res. 25:3389-3402.

Query= BP917935|Adiantum capillus-veneris mRNA, clone:
YMU001_000107_E08.
(500 letters)

Database: uniprot_sprot.fasta
412,525 sequences; 148,809,765 total letters

Searching..................................................done



Score E
Sequences producing significant alignments: (bits) Value

sp|A5DVD6|PAN1_LODEL Actin cytoskeleton-regulatory complex prote... 35 0.15
sp|Q46837|ACFD_ECOLI Putative lipoprotein acfD homolog OS=Escher... 35 0.19
sp|Q9PR99|Y046_UREPA Uncharacterized protein UU046 OS=Ureaplasma... 34 0.33
sp|A2ASS6|TITIN_MOUSE Titin OS=Mus musculus GN=Ttn PE=1 SV=1 34 0.43
sp|O65607|MSH3_ARATH DNA mismatch repair protein Msh3 OS=Arabido... 34 0.43
sp|Q5NZS1|IF2_AZOSE Translation initiation factor IF-2 OS=Azoarc... 34 0.43
sp|Q6GDH2|CLFB_STAAR Clumping factor B OS=Staphylococcus aureus ... 33 0.57
sp|Q17PR1|JING_AEDAE Zinc finger protein jing homolog OS=Aedes a... 33 0.74
sp|Q8T4N5|TSEP_GLOPP Protein TsetseEP OS=Glossina palpalis palpa... 33 0.96
sp|Q95P09|TSEP_GLOMM Protein TsetseEP OS=Glossina morsitans mors... 33 0.96
sp|P32652|POLG_MDMV Genome polyprotein (Fragment) OS=Maize dwarf... 33 0.96
sp|O10341|Y091_NPVOP Uncharacterized 29.3 kDa protein OS=Orgyia ... 32 1.3
sp|Q08DC7|RGS19_BOVIN Regulator of G-protein signaling 19 OS=Bos... 32 1.3
sp|P36021|MOT8_HUMAN Monocarboxylate transporter 8 OS=Homo sapie... 32 1.3
sp|P09516|MCAPS_BYDVP Minor capsid protein OS=Barley yellow dwar... 32 1.3
sp|Q5KSL6|DGKK_HUMAN Diacylglycerol kinase kappa OS=Homo sapiens... 32 1.3
sp|Q9HEV5|ASD4_NEUCR GATA type zinc finger protein asd-4 OS=Neur... 32 1.3
sp|P41479|Y091_NPVAC Uncharacterized 24.1 kDa protein in LEF4-P3... 32 1.6
sp|A9A5J1|RS19_NITMS 30S ribosomal protein S19P OS=Nitrosopumilu... 32 1.6
sp|Q7T037|RF12B_XENLA E3 ubiquitin-protein ligase rnf12-B OS=Xen... 32 1.6
sp|Q7TP98|ILF2_RAT Interleukin enhancer-binding factor 2 OS=Ratt... 32 1.6
sp|Q5RFJ1|ILF2_PONAB Interleukin enhancer-binding factor 2 OS=Po... 32 1.6
sp|Q9CXY6|ILF2_MOUSE Interleukin enhancer-binding factor 2 OS=Mu... 32 1.6
sp|Q12905|ILF2_HUMAN Interleukin enhancer-binding factor 2 OS=Ho... 32 1.6
sp|A7XYJ6|SOBPB_DANRE Sine oculis-binding protein homolog OS=Dan... 32 2.1
sp|Q54TC3|SLOB1_DICDI Probable inactive serine/threonine-protein... 32 2.1
sp|Q8NUL0|CLFB_STAAW Clumping factor B OS=Staphylococcus aureus ... 32 2.1
sp|Q6G644|CLFB_STAAS Clumping factor B OS=Staphylococcus aureus ... 32 2.1
sp|Q6LTU6|ZIPA_PHOPR Cell division protein zipA homolog OS=Photo... 31 2.8
sp|Q8N7U7|TPRX1_HUMAN Tetra-peptide repeat homeobox protein 1 OS... 31 2.8

>sp|A5DVD6|PAN1_LODEL Actin cytoskeleton-regulatory complex protein
PAN1 OS=Lodderomyces elongisporus GN=PAN1 PE=3 SV=1
Length = 1505

Score = 35.4 bits (80), Expect = 0.15
Identities = 18/39 (46%), Positives = 20/39 (51%)
Frame = +1

Query: 10 LPENPILPESTPAPVPNPFEFRKFPQTFPEPVPEPESTS 126
+P P LPES P P P P E PQ+ P P P P S
Sbjct: 1322 VPAAPSLPESVPPPAPAP-EAPSLPQSVPPPPPIPSEYS 1359



Score = 33.1 bits (74), Expect = 0.74
Identities = 18/49 (36%), Positives = 21/49 (42%), Gaps = 11/49 (22%)
Frame = +1

Query: 13 PENPILPESTPAPVPNPFEFR-----------KFPQTFPEPVPEPESTS 126
PE P LP+S P P P P E+ PQ+ P P P P S
Sbjct: 1374 PEAPSLPQSIPPPPPVPSEYSAPPAPPAPPAPSLPQSIPPPPPVPSEYS 1422



Score = 32.3 bits (72), Expect = 1.3
Identities = 18/43 (41%), Positives = 24/43 (55%), Gaps = 2/43 (4%)
Frame = +1

Query: 13 PENPILPESTPAPVPNPFEFRKFP-QTFPEPV-PEPESTSIQE 135
PE P LP+S P P P P E+ P + P V P PE+ S+ +
Sbjct: 1339 PEAPSLPQSVPPPPPIPSEYSAPPAPSLPRDVPPAPEAPSLPQ 1381


>sp|Q46837|ACFD_ECOLI Putative lipoprotein acfD homolog
OS=Escherichia coli (strain K12) GN=yghJ PE=4 SV=3
Length = 1520

Score = 35.0 bits (79), Expect = 0.19
Identities = 18/39 (46%), Positives = 24/39 (61%)
Frame = +1

Query: 7 NLPENPILPESTPAPVPNPFEFRKFPQTFPEPVPEPEST 123
+LPE + P+ TP P P P E P+ PEP+P+PE T
Sbjct: 44 SLPE--VKPDPTPNPEPTP-EPTPDPEPTPEPIPDPEPT 79



Score = 30.8 bits (68), Expect = 3.7
Identities = 16/37 (43%), Positives = 19/37 (51%)
Frame = +1

Query: 13 PENPILPESTPAPVPNPFEFRKFPQTFPEPVPEPEST 123
PE PE TP P+P+P + PEP PEP T
Sbjct: 60 PEPTPDPEPTPEPIPDP-------EPTPEPEPEPVPT 89


>sp|Q9PR99|Y046_UREPA Uncharacterized protein UU046 OS=Ureaplasma
parvum GN=UU046 PE=4 SV=1
Length = 791

Score = 34.3 bits (77), Expect = 0.33
Identities = 17/43 (39%), Positives = 21/43 (48%)
Frame = +1

Query: 13 PENPILPESTPAPVPNPFEFRKFPQTFPEPVPEPESTSIQEFL 141
PE P PE P P+P P PQ P+P P E+ +E L
Sbjct: 110 PEEPKKPEIKPEPIPKP-----KPQPIPQPTPPVETKPKEELL 147


>sp|A2ASS6|TITIN_MOUSE Titin OS=Mus musculus GN=Ttn PE=1 SV=1
Length = 35213

Score = 33.9 bits (76), Expect = 0.43
Identities = 16/51 (31%), Positives = 29/51 (56%), Gaps = 1/51 (1%)
Frame = +1

Query: 1 RRNLPENPILPEST-PAPVPNPFEFRKFPQTFPEPVPEPESTSIQEFLLRR 150
++ +PE P + E PAP+ P +K + PEP P+P+ + + +LR+
Sbjct: 12696 KKKVPEKPEVVEKVEPAPLKVPTAEKKVRKLLPEPKPQPKEEVVLKSVLRK 12746


>sp|O65607|MSH3_ARATH DNA mismatch repair protein Msh3
OS=Arabidopsis thaliana GN=MSH3 PE=2 SV=2
Length = 1081

Score = 33.9 bits (76), Expect = 0.43
Identities = 18/45 (40%), Positives = 27/45 (60%), Gaps = 3/45 (6%)
Frame = +1

Query: 13 PENPILPESTPAPVPNPFEFRKFPQTFPEPVPE---PESTSIQEF 138
P+ P L T PVP+P ++F Q F EP PE PE++S +++
Sbjct: 60 PKKPKLSPHTQNPVPDPNLHQRFLQRFLEPSPEEYVPETSSSRKY 104


>sp|Q5NZS1|IF2_AZOSE Translation initiation factor IF-2 OS=Azoarcus
sp. (strain EbN1) GN=infB PE=3 SV=1
Length = 945

Score = 33.9 bits (76), Expect = 0.43
Identities = 17/40 (42%), Positives = 21/40 (52%)
Frame = +1

Query: 13 PENPILPESTPAPVPNPFEFRKFPQTFPEPVPEPESTSIQ 132
PE + PE P P P P PQ PEP PEPE +++
Sbjct: 155 PEPIVEPEPEPEPEPEPE-----PQPEPEPRPEPEPATVE 189


>sp|Q6GDH2|CLFB_STAAR Clumping factor B OS=Staphylococcus aureus
(strain MRSA252) GN=clfB PE=3 SV=1
Length = 873

Score = 33.5 bits (75), Expect = 0.57
Identities = 15/35 (42%), Positives = 19/35 (54%)
Frame = +1

Query: 13 PENPILPESTPAPVPNPFEFRKFPQTFPEPVPEPE 117
P P+ PE P P P+P P+ PEP P+PE
Sbjct: 548 PGPPVDPEPEPEPTPDP---EPSPEPEPEPTPDPE 579


>sp|Q17PR1|JING_AEDAE Zinc finger protein jing homolog OS=Aedes
aegypti GN=AAEL000263 PE=3 SV=1
Length = 1605

Score = 33.1 bits (74), Expect = 0.74
Identities = 16/32 (50%), Positives = 21/32 (65%), Gaps = 4/32 (12%)
Frame = +1

Query: 34 ESTPAPVPNPFEFRKFP----QTFPEPVPEPE 117
ESTP+PVP+P + P ++ PEP PEPE
Sbjct: 1031 ESTPSPVPSPSPLSEPPVIPAESEPEPEPEPE 1062



Score = 32.7 bits (73), Expect = 0.96
Identities = 18/37 (48%), Positives = 21/37 (56%), Gaps = 1/37 (2%)
Frame = +1

Query: 10 LPENPILP-ESTPAPVPNPFEFRKFPQTFPEPVPEPE 117
L E P++P ES P P P P E P+ PEP EPE
Sbjct: 1043 LSEPPVIPAESEPEPEPEP-ELEPEPEMEPEPETEPE 1078


>sp|Q8T4N5|TSEP_GLOPP Protein TsetseEP OS=Glossina palpalis palpalis
PE=4 SV=1
Length = 374

Score = 32.7 bits (73), Expect = 0.96
Identities = 18/36 (50%), Positives = 19/36 (52%)
Frame = +1

Query: 10 LPENPILPESTPAPVPNPFEFRKFPQTFPEPVPEPE 117
LPE PE P P P P E P+ PEP PEPE
Sbjct: 193 LPEPEPEPEPEPEPEPEP-EPEPEPEPEPEPEPEPE 227



Score = 32.7 bits (73), Expect = 0.96
Identities = 18/36 (50%), Positives = 19/36 (52%)
Frame = +1

Query: 13 PENPILPESTPAPVPNPFEFRKFPQTFPEPVPEPES 120
PE PE P P P P E P+ PEP PEPES
Sbjct: 332 PEPEPEPEPEPEPEPEP-EPEPEPEPEPEPEPEPES 366



Score = 32.0 bits (71), Expect = 1.6
Identities = 18/38 (47%), Positives = 19/38 (50%)
Frame = +1

Query: 13 PENPILPESTPAPVPNPFEFRKFPQTFPEPVPEPESTS 126
PE PE P P P P E P+ PEP PEPE S
Sbjct: 330 PEPEPEPEPEPEPEPEP-EPEPEPEPEPEPEPEPEPES 366



Score = 31.2 bits (69), Expect = 2.8
Identities = 17/35 (48%), Positives = 18/35 (51%)
Frame = +1

Query: 13 PENPILPESTPAPVPNPFEFRKFPQTFPEPVPEPE 117
PE PE P P P P E P+ PEP PEPE
Sbjct: 198 PEPEPEPEPEPEPEPEP-EPEPEPEPEPEPEPEPE 231



Score = 31.2 bits (69), Expect = 2.8
Identities = 17/35 (48%), Positives = 18/35 (51%)
Frame = +1

Query: 13 PENPILPESTPAPVPNPFEFRKFPQTFPEPVPEPE 117
PE PE P P P P E P+ PEP PEPE
Sbjct: 200 PEPEPEPEPEPEPEPEP-EPEPEPEPEPEPEPEPE 233



Score = 31.2 bits (69), Expect = 2.8
Identities = 17/35 (48%), Positives = 18/35 (51%)
Frame = +1

Query: 13 PENPILPESTPAPVPNPFEFRKFPQTFPEPVPEPE 117
PE PE P P P P E P+ PEP PEPE
Sbjct: 202 PEPEPEPEPEPEPEPEP-EPEPEPEPEPEPEPEPE 235



Score = 31.2 bits (69), Expect = 2.8
Identities = 17/35 (48%), Positives = 18/35 (51%)
Frame = +1

Query: 13 PENPILPESTPAPVPNPFEFRKFPQTFPEPVPEPE 117
PE PE P P P P E P+ PEP PEPE
Sbjct: 204 PEPEPEPEPEPEPEPEP-EPEPEPEPEPEPEPEPE 237



Score = 31.2 bits (69), Expect = 2.8
Identities = 17/35 (48%), Positives = 18/35 (51%)
Frame = +1

Query: 13 PENPILPESTPAPVPNPFEFRKFPQTFPEPVPEPE 117
PE PE P P P P E P+ PEP PEPE
Sbjct: 206 PEPEPEPEPEPEPEPEP-EPEPEPEPEPEPEPEPE 239



Score = 31.2 bits (69), Expect = 2.8
Identities = 17/35 (48%), Positives = 18/35 (51%)
Frame = +1

Query: 13 PENPILPESTPAPVPNPFEFRKFPQTFPEPVPEPE 117
PE PE P P P P E P+ PEP PEPE
Sbjct: 208 PEPEPEPEPEPEPEPEP-EPEPEPEPEPEPEPEPE 241



Score = 31.2 bits (69), Expect = 2.8
Identities = 17/35 (48%), Positives = 18/35 (51%)
Frame = +1

Query: 13 PENPILPESTPAPVPNPFEFRKFPQTFPEPVPEPE 117
PE PE P P P P E P+ PEP PEPE
Sbjct: 210 PEPEPEPEPEPEPEPEP-EPEPEPEPEPEPEPEPE 243



Score = 31.2 bits (69), Expect = 2.8
Identities = 17/35 (48%), Positives = 18/35 (51%)
Frame = +1

Query: 13 PENPILPESTPAPVPNPFEFRKFPQTFPEPVPEPE 117
PE PE P P P P E P+ PEP PEPE
Sbjct: 212 PEPEPEPEPEPEPEPEP-EPEPEPEPEPEPEPEPE 245



Score = 31.2 bits (69), Expect = 2.8
Identities = 17/35 (48%), Positives = 18/35 (51%)
Frame = +1

Query: 13 PENPILPESTPAPVPNPFEFRKFPQTFPEPVPEPE 117
PE PE P P P P E P+ PEP PEPE
Sbjct: 214 PEPEPEPEPEPEPEPEP-EPEPEPEPEPEPEPEPE 247



Score = 31.2 bits (69), Expect = 2.8
Identities = 17/35 (48%), Positives = 18/35 (51%)
Frame = +1

Query: 13 PENPILPESTPAPVPNPFEFRKFPQTFPEPVPEPE 117
PE PE P P P P E P+ PEP PEPE
Sbjct: 216 PEPEPEPEPEPEPEPEP-EPEPEPEPEPEPEPEPE 249



Score = 31.2 bits (69), Expect = 2.8
Identities = 17/35 (48%), Positives = 18/35 (51%)
Frame = +1

Query: 13 PENPILPESTPAPVPNPFEFRKFPQTFPEPVPEPE 117
PE PE P P P P E P+ PEP PEPE
Sbjct: 218 PEPEPEPEPEPEPEPEP-EPEPEPEPEPEPEPEPE 251



Score = 31.2 bits (69), Expect = 2.8
Identities = 17/35 (48%), Positives = 18/35 (51%)
Frame = +1

Query: 13 PENPILPESTPAPVPNPFEFRKFPQTFPEPVPEPE 117
PE PE P P P P E P+ PEP PEPE
Sbjct: 220 PEPEPEPEPEPEPEPEP-EPEPEPEPEPEPEPEPE 253



Score = 31.2 bits (69), Expect = 2.8
Identities = 17/35 (48%), Positives = 18/35 (51%)
Frame = +1

Query: 13 PENPILPESTPAPVPNPFEFRKFPQTFPEPVPEPE 117
PE PE P P P P E P+ PEP PEPE
Sbjct: 222 PEPEPEPEPEPEPEPEP-EPEPEPEPEPEPEPEPE 255



Score = 31.2 bits (69), Expect = 2.8
Identities = 17/35 (48%), Positives = 18/35 (51%)
Frame = +1

Query: 13 PENPILPESTPAPVPNPFEFRKFPQTFPEPVPEPE 117
PE PE P P P P E P+ PEP PEPE
Sbjct: 224 PEPEPEPEPEPEPEPEP-EPEPEPEPEPEPEPEPE 257



Score = 31.2 bits (69), Expect = 2.8
Identities = 17/35 (48%), Positives = 18/35 (51%)
Frame = +1

Query: 13 PENPILPESTPAPVPNPFEFRKFPQTFPEPVPEPE 117
PE PE P P P P E P+ PEP PEPE
Sbjct: 226 PEPEPEPEPEPEPEPEP-EPEPEPEPEPEPEPEPE 259



Score = 31.2 bits (69), Expect = 2.8
Identities = 17/35 (48%), Positives = 18/35 (51%)
Frame = +1

Query: 13 PENPILPESTPAPVPNPFEFRKFPQTFPEPVPEPE 117
PE PE P P P P E P+ PEP PEPE
Sbjct: 228 PEPEPEPEPEPEPEPEP-EPEPEPEPEPEPEPEPE 261



Score = 31.2 bits (69), Expect = 2.8
Identities = 17/35 (48%), Positives = 18/35 (51%)
Frame = +1

Query: 13 PENPILPESTPAPVPNPFEFRKFPQTFPEPVPEPE 117
PE PE P P P P E P+ PEP PEPE
Sbjct: 230 PEPEPEPEPEPEPEPEP-EPEPEPEPEPEPEPEPE 263



Score = 31.2 bits (69), Expect = 2.8
Identities = 17/35 (48%), Positives = 18/35 (51%)
Frame = +1

Query: 13 PENPILPESTPAPVPNPFEFRKFPQTFPEPVPEPE 117
PE PE P P P P E P+ PEP PEPE
Sbjct: 232 PEPEPEPEPEPEPEPEP-EPEPEPEPEPEPEPEPE 265



Score = 31.2 bits (69), Expect = 2.8
Identities = 17/35 (48%), Positives = 18/35 (51%)
Frame = +1

Query: 13 PENPILPESTPAPVPNPFEFRKFPQTFPEPVPEPE 117
PE PE P P P P E P+ PEP PEPE
Sbjct: 234 PEPEPEPEPEPEPEPEP-EPEPEPEPEPEPEPEPE 267



Score = 31.2 bits (69), Expect = 2.8
Identities = 17/35 (48%), Positives = 18/35 (51%)
Frame = +1

Query: 13 PENPILPESTPAPVPNPFEFRKFPQTFPEPVPEPE 117
PE PE P P P P E P+ PEP PEPE
Sbjct: 236 PEPEPEPEPEPEPEPEP-EPEPEPEPEPEPEPEPE 269



Score = 31.2 bits (69), Expect = 2.8
Identities = 17/35 (48%), Positives = 18/35 (51%)
Frame = +1

Query: 13 PENPILPESTPAPVPNPFEFRKFPQTFPEPVPEPE 117
PE PE P P P P E P+ PEP PEPE
Sbjct: 238 PEPEPEPEPEPEPEPEP-EPEPEPEPEPEPEPEPE 271



Score = 31.2 bits (69), Expect = 2.8
Identities = 17/35 (48%), Positives = 18/35 (51%)
Frame = +1

Query: 13 PENPILPESTPAPVPNPFEFRKFPQTFPEPVPEPE 117
PE PE P P P P E P+ PEP PEPE
Sbjct: 240 PEPEPEPEPEPEPEPEP-EPEPEPEPEPEPEPEPE 273



Score = 31.2 bits (69), Expect = 2.8
Identities = 17/35 (48%), Positives = 18/35 (51%)
Frame = +1

Query: 13 PENPILPESTPAPVPNPFEFRKFPQTFPEPVPEPE 117
PE PE P P P P E P+ PEP PEPE
Sbjct: 242 PEPEPEPEPEPEPEPEP-EPEPEPEPEPEPEPEPE 275



Score = 31.2 bits (69), Expect = 2.8
Identities = 17/35 (48%), Positives = 18/35 (51%)
Frame = +1

Query: 13 PENPILPESTPAPVPNPFEFRKFPQTFPEPVPEPE 117
PE PE P P P P E P+ PEP PEPE
Sbjct: 244 PEPEPEPEPEPEPEPEP-EPEPEPEPEPEPEPEPE 277



Score = 31.2 bits (69), Expect = 2.8
Identities = 17/35 (48%), Positives = 18/35 (51%)
Frame = +1

Query: 13 PENPILPESTPAPVPNPFEFRKFPQTFPEPVPEPE 117
PE PE P P P P E P+ PEP PEPE
Sbjct: 246 PEPEPEPEPEPEPEPEP-EPEPEPEPEPEPEPEPE 279



Score = 31.2 bits (69), Expect = 2.8
Identities = 17/35 (48%), Positives = 18/35 (51%)
Frame = +1

Query: 13 PENPILPESTPAPVPNPFEFRKFPQTFPEPVPEPE 117
PE PE P P P P E P+ PEP PEPE
Sbjct: 248 PEPEPEPEPEPEPEPEP-EPEPEPEPEPEPEPEPE 281



Score = 31.2 bits (69), Expect = 2.8
Identities = 17/35 (48%), Positives = 18/35 (51%)
Frame = +1

Query: 13 PENPILPESTPAPVPNPFEFRKFPQTFPEPVPEPE 117
PE PE P P P P E P+ PEP PEPE
Sbjct: 250 PEPEPEPEPEPEPEPEP-EPEPEPEPEPEPEPEPE 283



Score = 31.2 bits (69), Expect = 2.8
Identities = 17/35 (48%), Positives = 18/35 (51%)
Frame = +1

Query: 13 PENPILPESTPAPVPNPFEFRKFPQTFPEPVPEPE 117
PE PE P P P P E P+ PEP PEPE
Sbjct: 252 PEPEPEPEPEPEPEPEP-EPEPEPEPEPEPEPEPE 285



Score = 31.2 bits (69), Expect = 2.8
Identities = 17/35 (48%), Positives = 18/35 (51%)
Frame = +1

Query: 13 PENPILPESTPAPVPNPFEFRKFPQTFPEPVPEPE 117
PE PE P P P P E P+ PEP PEPE
Sbjct: 254 PEPEPEPEPEPEPEPEP-EPEPEPEPEPEPEPEPE 287



Score = 31.2 bits (69), Expect = 2.8
Identities = 17/35 (48%), Positives = 18/35 (51%)
Frame = +1

Query: 13 PENPILPESTPAPVPNPFEFRKFPQTFPEPVPEPE 117
PE PE P P P P E P+ PEP PEPE
Sbjct: 256 PEPEPEPEPEPEPEPEP-EPEPEPEPEPEPEPEPE 289



Score = 31.2 bits (69), Expect = 2.8
Identities = 17/35 (48%), Positives = 18/35 (51%)
Frame = +1

Query: 13 PENPILPESTPAPVPNPFEFRKFPQTFPEPVPEPE 117
PE PE P P P P E P+ PEP PEPE
Sbjct: 258 PEPEPEPEPEPEPEPEP-EPEPEPEPEPEPEPEPE 291



Score = 31.2 bits (69), Expect = 2.8
Identities = 17/35 (48%), Positives = 18/35 (51%)
Frame = +1

Query: 13 PENPILPESTPAPVPNPFEFRKFPQTFPEPVPEPE 117
PE PE P P P P E P+ PEP PEPE
Sbjct: 260 PEPEPEPEPEPEPEPEP-EPEPEPEPEPEPEPEPE 293



Score = 31.2 bits (69), Expect = 2.8
Identities = 17/35 (48%), Positives = 18/35 (51%)
Frame = +1

Query: 13 PENPILPESTPAPVPNPFEFRKFPQTFPEPVPEPE 117
PE PE P P P P E P+ PEP PEPE
Sbjct: 262 PEPEPEPEPEPEPEPEP-EPEPEPEPEPEPEPEPE 295



Score = 31.2 bits (69), Expect = 2.8
Identities = 17/35 (48%), Positives = 18/35 (51%)
Frame = +1

Query: 13 PENPILPESTPAPVPNPFEFRKFPQTFPEPVPEPE 117
PE PE P P P P E P+ PEP PEPE
Sbjct: 264 PEPEPEPEPEPEPEPEP-EPEPEPEPEPEPEPEPE 297



Score = 31.2 bits (69), Expect = 2.8
Identities = 17/35 (48%), Positives = 18/35 (51%)
Frame = +1

Query: 13 PENPILPESTPAPVPNPFEFRKFPQTFPEPVPEPE 117
PE PE P P P P E P+ PEP PEPE
Sbjct: 266 PEPEPEPEPEPEPEPEP-EPEPEPEPEPEPEPEPE 299



Score = 31.2 bits (69), Expect = 2.8
Identities = 17/35 (48%), Positives = 18/35 (51%)
Frame = +1

Query: 13 PENPILPESTPAPVPNPFEFRKFPQTFPEPVPEPE 117
PE PE P P P P E P+ PEP PEPE
Sbjct: 268 PEPEPEPEPEPEPEPEP-EPEPEPEPEPEPEPEPE 301



Score = 31.2 bits (69), Expect = 2.8
Identities = 17/35 (48%), Positives = 18/35 (51%)
Frame = +1

Query: 13 PENPILPESTPAPVPNPFEFRKFPQTFPEPVPEPE 117
PE PE P P P P E P+ PEP PEPE
Sbjct: 270 PEPEPEPEPEPEPEPEP-EPEPEPEPEPEPEPEPE 303



Score = 31.2 bits (69), Expect = 2.8
Identities = 17/35 (48%), Positives = 18/35 (51%)
Frame = +1

Query: 13 PENPILPESTPAPVPNPFEFRKFPQTFPEPVPEPE 117
PE PE P P P P E P+ PEP PEPE
Sbjct: 272 PEPEPEPEPEPEPEPEP-EPEPEPEPEPEPEPEPE 305



Score = 31.2 bits (69), Expect = 2.8
Identities = 17/35 (48%), Positives = 18/35 (51%)
Frame = +1

Query: 13 PENPILPESTPAPVPNPFEFRKFPQTFPEPVPEPE 117
PE PE P P P P E P+ PEP PEPE
Sbjct: 274 PEPEPEPEPEPEPEPEP-EPEPEPEPEPEPEPEPE 307



Score = 31.2 bits (69), Expect = 2.8
Identities = 17/35 (48%), Positives = 18/35 (51%)
Frame = +1

Query: 13 PENPILPESTPAPVPNPFEFRKFPQTFPEPVPEPE 117
PE PE P P P P E P+ PEP PEPE
Sbjct: 276 PEPEPEPEPEPEPEPEP-EPEPEPEPEPEPEPEPE 309



Score = 31.2 bits (69), Expect = 2.8
Identities = 17/35 (48%), Positives = 18/35 (51%)
Frame = +1

Query: 13 PENPILPESTPAPVPNPFEFRKFPQTFPEPVPEPE 117
PE PE P P P P E P+ PEP PEPE
Sbjct: 278 PEPEPEPEPEPEPEPEP-EPEPEPEPEPEPEPEPE 311



Score = 31.2 bits (69), Expect = 2.8
Identities = 17/35 (48%), Positives = 18/35 (51%)
Frame = +1

Query: 13 PENPILPESTPAPVPNPFEFRKFPQTFPEPVPEPE 117
PE PE P P P P E P+ PEP PEPE
Sbjct: 280 PEPEPEPEPEPEPEPEP-EPEPEPEPEPEPEPEPE 313



Score = 31.2 bits (69), Expect = 2.8
Identities = 17/35 (48%), Positives = 18/35 (51%)
Frame = +1

Query: 13 PENPILPESTPAPVPNPFEFRKFPQTFPEPVPEPE 117
PE PE P P P P E P+ PEP PEPE
Sbjct: 282 PEPEPEPEPEPEPEPEP-EPEPEPEPEPEPEPEPE 315



Score = 31.2 bits (69), Expect = 2.8
Identities = 17/35 (48%), Positives = 18/35 (51%)
Frame = +1

Query: 13 PENPILPESTPAPVPNPFEFRKFPQTFPEPVPEPE 117
PE PE P P P P E P+ PEP PEPE
Sbjct: 284 PEPEPEPEPEPEPEPEP-EPEPEPEPEPEPEPEPE 317



Score = 31.2 bits (69), Expect = 2.8
Identities = 17/35 (48%), Positives = 18/35 (51%)
Frame = +1

Query: 13 PENPILPESTPAPVPNPFEFRKFPQTFPEPVPEPE 117
PE PE P P P P E P+ PEP PEPE
Sbjct: 286 PEPEPEPEPEPEPEPEP-EPEPEPEPEPEPEPEPE 319



Score = 31.2 bits (69), Expect = 2.8
Identities = 17/35 (48%), Positives = 18/35 (51%)
Frame = +1

Query: 13 PENPILPESTPAPVPNPFEFRKFPQTFPEPVPEPE 117
PE PE P P P P E P+ PEP PEPE
Sbjct: 288 PEPEPEPEPEPEPEPEP-EPEPEPEPEPEPEPEPE 321



Score = 31.2 bits (69), Expect = 2.8
Identities = 17/35 (48%), Positives = 18/35 (51%)
Frame = +1

Query: 13 PENPILPESTPAPVPNPFEFRKFPQTFPEPVPEPE 117
PE PE P P P P E P+ PEP PEPE
Sbjct: 290 PEPEPEPEPEPEPEPEP-EPEPEPEPEPEPEPEPE 323



Score = 31.2 bits (69), Expect = 2.8
Identities = 17/35 (48%), Positives = 18/35 (51%)
Frame = +1

Query: 13 PENPILPESTPAPVPNPFEFRKFPQTFPEPVPEPE 117
PE PE P P P P E P+ PEP PEPE
Sbjct: 292 PEPEPEPEPEPEPEPEP-EPEPEPEPEPEPEPEPE 325



Score = 31.2 bits (69), Expect = 2.8
Identities = 17/35 (48%), Positives = 18/35 (51%)
Frame = +1

Query: 13 PENPILPESTPAPVPNPFEFRKFPQTFPEPVPEPE 117
PE PE P P P P E P+ PEP PEPE
Sbjct: 294 PEPEPEPEPEPEPEPEP-EPEPEPEPEPEPEPEPE 327



Score = 31.2 bits (69), Expect = 2.8
Identities = 17/35 (48%), Positives = 18/35 (51%)
Frame = +1

Query: 13 PENPILPESTPAPVPNPFEFRKFPQTFPEPVPEPE 117
PE PE P P P P E P+ PEP PEPE
Sbjct: 296 PEPEPEPEPEPEPEPEP-EPEPEPEPEPEPEPEPE 329



Score = 31.2 bits (69), Expect = 2.8
Identities = 17/35 (48%), Positives = 18/35 (51%)
Frame = +1

Query: 13 PENPILPESTPAPVPNPFEFRKFPQTFPEPVPEPE 117
PE PE P P P P E P+ PEP PEPE
Sbjct: 298 PEPEPEPEPEPEPEPEP-EPEPEPEPEPEPEPEPE 331



Score = 31.2 bits (69), Expect = 2.8
Identities = 17/35 (48%), Positives = 18/35 (51%)
Frame = +1

Query: 13 PENPILPESTPAPVPNPFEFRKFPQTFPEPVPEPE 117
PE PE P P P P E P+ PEP PEPE
Sbjct: 300 PEPEPEPEPEPEPEPEP-EPEPEPEPEPEPEPEPE 333



Score = 31.2 bits (69), Expect = 2.8
Identities = 17/35 (48%), Positives = 18/35 (51%)
Frame = +1

Query: 13 PENPILPESTPAPVPNPFEFRKFPQTFPEPVPEPE 117
PE PE P P P P E P+ PEP PEPE
Sbjct: 302 PEPEPEPEPEPEPEPEP-EPEPEPEPEPEPEPEPE 335



Score = 31.2 bits (69), Expect = 2.8
Identities = 17/35 (48%), Positives = 18/35 (51%)
Frame = +1

Query: 13 PENPILPESTPAPVPNPFEFRKFPQTFPEPVPEPE 117
PE PE P P P P E P+ PEP PEPE
Sbjct: 304 PEPEPEPEPEPEPEPEP-EPEPEPEPEPEPEPEPE 337



Score = 31.2 bits (69), Expect = 2.8
Identities = 17/35 (48%), Positives = 18/35 (51%)
Frame = +1

Query: 13 PENPILPESTPAPVPNPFEFRKFPQTFPEPVPEPE 117
PE PE P P P P E P+ PEP PEPE
Sbjct: 306 PEPEPEPEPEPEPEPEP-EPEPEPEPEPEPEPEPE 339


>sp|Q95P09|TSEP_GLOMM Protein TsetseEP OS=Glossina morsitans
morsitans PE=1 SV=1
Length = 320

Score = 32.7 bits (73), Expect = 0.96
Identities = 18/36 (50%), Positives = 19/36 (52%)
Frame = +1

Query: 10 LPENPILPESTPAPVPNPFEFRKFPQTFPEPVPEPE 117
LPE PE P P P P E P+ PEP PEPE
Sbjct: 193 LPEPEPEPEPEPEPEPEP-EPEPEPEPEPEPEPEPE 227



Score = 32.7 bits (73), Expect = 0.96
Identities = 18/36 (50%), Positives = 19/36 (52%)
Frame = +1

Query: 13 PENPILPESTPAPVPNPFEFRKFPQTFPEPVPEPES 120
PE PE P P P P E P+ PEP PEPES
Sbjct: 278 PEPEPEPEPEPEPEPEP-EPEPEPEPEPEPQPEPES 312



Score = 31.2 bits (69), Expect = 2.8
Identities = 17/35 (48%), Positives = 18/35 (51%)
Frame = +1

Query: 13 PENPILPESTPAPVPNPFEFRKFPQTFPEPVPEPE 117
PE PE P P P P E P+ PEP PEPE
Sbjct: 198 PEPEPEPEPEPEPEPEP-EPEPEPEPEPEPEPEPE 231



Score = 31.2 bits (69), Expect = 2.8
Identities = 17/35 (48%), Positives = 18/35 (51%)
Frame = +1

Query: 13 PENPILPESTPAPVPNPFEFRKFPQTFPEPVPEPE 117
PE PE P P P P E P+ PEP PEPE
Sbjct: 200 PEPEPEPEPEPEPEPEP-EPEPEPEPEPEPEPEPE 233



Score = 31.2 bits (69), Expect = 2.8
Identities = 17/35 (48%), Positives = 18/35 (51%)
Frame = +1

Query: 13 PENPILPESTPAPVPNPFEFRKFPQTFPEPVPEPE 117
PE PE P P P P E P+ PEP PEPE
Sbjct: 202 PEPEPEPEPEPEPEPEP-EPEPEPEPEPEPEPEPE 235



Score = 31.2 bits (69), Expect = 2.8
Identities = 17/35 (48%), Positives = 18/35 (51%)
Frame = +1

Query: 13 PENPILPESTPAPVPNPFEFRKFPQTFPEPVPEPE 117
PE PE P P P P E P+ PEP PEPE
Sbjct: 204 PEPEPEPEPEPEPEPEP-EPEPEPEPEPEPEPEPE 237



Score = 31.2 bits (69), Expect = 2.8
Identities = 17/35 (48%), Positives = 18/35 (51%)
Frame = +1

Query: 13 PENPILPESTPAPVPNPFEFRKFPQTFPEPVPEPE 117
PE PE P P P P E P+ PEP PEPE
Sbjct: 206 PEPEPEPEPEPEPEPEP-EPEPEPEPEPEPEPEPE 239



Score = 31.2 bits (69), Expect = 2.8
Identities = 17/35 (48%), Positives = 18/35 (51%)
Frame = +1

Query: 13 PENPILPESTPAPVPNPFEFRKFPQTFPEPVPEPE 117
PE PE P P P P E P+ PEP PEPE
Sbjct: 208 PEPEPEPEPEPEPEPEP-EPEPEPEPEPEPEPEPE 241



Score = 31.2 bits (69), Expect = 2.8
Identities = 17/35 (48%), Positives = 18/35 (51%)
Frame = +1

Query: 13 PENPILPESTPAPVPNPFEFRKFPQTFPEPVPEPE 117
PE PE P P P P E P+ PEP PEPE
Sbjct: 210 PEPEPEPEPEPEPEPEP-EPEPEPEPEPEPEPEPE 243



Score = 31.2 bits (69), Expect = 2.8
Identities = 17/35 (48%), Positives = 18/35 (51%)
Frame = +1

Query: 13 PENPILPESTPAPVPNPFEFRKFPQTFPEPVPEPE 117
PE PE P P P P E P+ PEP PEPE
Sbjct: 212 PEPEPEPEPEPEPEPEP-EPEPEPEPEPEPEPEPE 245



Score = 31.2 bits (69), Expect = 2.8
Identities = 17/35 (48%), Positives = 18/35 (51%)
Frame = +1

Query: 13 PENPILPESTPAPVPNPFEFRKFPQTFPEPVPEPE 117
PE PE P P P P E P+ PEP PEPE
Sbjct: 214 PEPEPEPEPEPEPEPEP-EPEPEPEPEPEPEPEPE 247



Score = 31.2 bits (69), Expect = 2.8
Identities = 17/35 (48%), Positives = 18/35 (51%)
Frame = +1

Query: 13 PENPILPESTPAPVPNPFEFRKFPQTFPEPVPEPE 117
PE PE P P P P E P+ PEP PEPE
Sbjct: 216 PEPEPEPEPEPEPEPEP-EPEPEPEPEPEPEPEPE 249



Score = 31.2 bits (69), Expect = 2.8
Identities = 17/35 (48%), Positives = 18/35 (51%)
Frame = +1

Query: 13 PENPILPESTPAPVPNPFEFRKFPQTFPEPVPEPE 117
PE PE P P P P E P+ PEP PEPE
Sbjct: 218 PEPEPEPEPEPEPEPEP-EPEPEPEPEPEPEPEPE 251



Score = 31.2 bits (69), Expect = 2.8
Identities = 17/35 (48%), Positives = 18/35 (51%)
Frame = +1

Query: 13 PENPILPESTPAPVPNPFEFRKFPQTFPEPVPEPE 117
PE PE P P P P E P+ PEP PEPE
Sbjct: 220 PEPEPEPEPEPEPEPEP-EPEPEPEPEPEPEPEPE 253



Score = 31.2 bits (69), Expect = 2.8
Identities = 17/35 (48%), Positives = 18/35 (51%)
Frame = +1

Query: 13 PENPILPESTPAPVPNPFEFRKFPQTFPEPVPEPE 117
PE PE P P P P E P+ PEP PEPE
Sbjct: 222 PEPEPEPEPEPEPEPEP-EPEPEPEPEPEPEPEPE 255



Score = 31.2 bits (69), Expect = 2.8
Identities = 17/35 (48%), Positives = 18/35 (51%)
Frame = +1

Query: 13 PENPILPESTPAPVPNPFEFRKFPQTFPEPVPEPE 117
PE PE P P P P E P+ PEP PEPE
Sbjct: 224 PEPEPEPEPEPEPEPEP-EPEPEPEPEPEPEPEPE 257



Score = 31.2 bits (69), Expect = 2.8
Identities = 17/35 (48%), Positives = 18/35 (51%)
Frame = +1

Query: 13 PENPILPESTPAPVPNPFEFRKFPQTFPEPVPEPE 117
PE PE P P P P E P+ PEP PEPE
Sbjct: 226 PEPEPEPEPEPEPEPEP-EPEPEPEPEPEPEPEPE 259



Score = 31.2 bits (69), Expect = 2.8
Identities = 17/35 (48%), Positives = 18/35 (51%)
Frame = +1

Query: 13 PENPILPESTPAPVPNPFEFRKFPQTFPEPVPEPE 117
PE PE P P P P E P+ PEP PEPE
Sbjct: 228 PEPEPEPEPEPEPEPEP-EPEPEPEPEPEPEPEPE 261



Score = 31.2 bits (69), Expect = 2.8
Identities = 17/35 (48%), Positives = 18/35 (51%)
Frame = +1

Query: 13 PENPILPESTPAPVPNPFEFRKFPQTFPEPVPEPE 117
PE PE P P P P E P+ PEP PEPE
Sbjct: 230 PEPEPEPEPEPEPEPEP-EPEPEPEPEPEPEPEPE 263



Score = 31.2 bits (69), Expect = 2.8
Identities = 17/35 (48%), Positives = 18/35 (51%)
Frame = +1

Query: 13 PENPILPESTPAPVPNPFEFRKFPQTFPEPVPEPE 117
PE PE P P P P E P+ PEP PEPE
Sbjct: 232 PEPEPEPEPEPEPEPEP-EPEPEPEPEPEPEPEPE 265



Score = 31.2 bits (69), Expect = 2.8
Identities = 17/35 (48%), Positives = 18/35 (51%)
Frame = +1

Query: 13 PENPILPESTPAPVPNPFEFRKFPQTFPEPVPEPE 117
PE PE P P P P E P+ PEP PEPE
Sbjct: 234 PEPEPEPEPEPEPEPEP-EPEPEPEPEPEPEPEPE 267



Score = 31.2 bits (69), Expect = 2.8
Identities = 17/35 (48%), Positives = 18/35 (51%)
Frame = +1

Query: 13 PENPILPESTPAPVPNPFEFRKFPQTFPEPVPEPE 117
PE PE P P P P E P+ PEP PEPE
Sbjct: 236 PEPEPEPEPEPEPEPEP-EPEPEPEPEPEPEPEPE 269



Score = 31.2 bits (69), Expect = 2.8
Identities = 17/35 (48%), Positives = 18/35 (51%)
Frame = +1

Query: 13 PENPILPESTPAPVPNPFEFRKFPQTFPEPVPEPE 117
PE PE P P P P E P+ PEP PEPE
Sbjct: 238 PEPEPEPEPEPEPEPEP-EPEPEPEPEPEPEPEPE 271



Score = 31.2 bits (69), Expect = 2.8
Identities = 17/35 (48%), Positives = 18/35 (51%)
Frame = +1

Query: 13 PENPILPESTPAPVPNPFEFRKFPQTFPEPVPEPE 117
PE PE P P P P E P+ PEP PEPE
Sbjct: 240 PEPEPEPEPEPEPEPEP-EPEPEPEPEPEPEPEPE 273



Score = 31.2 bits (69), Expect = 2.8
Identities = 17/35 (48%), Positives = 18/35 (51%)
Frame = +1

Query: 13 PENPILPESTPAPVPNPFEFRKFPQTFPEPVPEPE 117
PE PE P P P P E P+ PEP PEPE
Sbjct: 242 PEPEPEPEPEPEPEPEP-EPEPEPEPEPEPEPEPE 275



Score = 31.2 bits (69), Expect = 2.8
Identities = 17/35 (48%), Positives = 18/35 (51%)
Frame = +1

Query: 13 PENPILPESTPAPVPNPFEFRKFPQTFPEPVPEPE 117
PE PE P P P P E P+ PEP PEPE
Sbjct: 244 PEPEPEPEPEPEPEPEP-EPEPEPEPEPEPEPEPE 277



Score = 31.2 bits (69), Expect = 2.8
Identities = 17/35 (48%), Positives = 18/35 (51%)
Frame = +1

Query: 13 PENPILPESTPAPVPNPFEFRKFPQTFPEPVPEPE 117
PE PE P P P P E P+ PEP PEPE
Sbjct: 246 PEPEPEPEPEPEPEPEP-EPEPEPEPEPEPEPEPE 279



Score = 31.2 bits (69), Expect = 2.8
Identities = 17/35 (48%), Positives = 18/35 (51%)
Frame = +1

Query: 13 PENPILPESTPAPVPNPFEFRKFPQTFPEPVPEPE 117
PE PE P P P P E P+ PEP PEPE
Sbjct: 248 PEPEPEPEPEPEPEPEP-EPEPEPEPEPEPEPEPE 281



Score = 31.2 bits (69), Expect = 2.8
Identities = 17/35 (48%), Positives = 18/35 (51%)
Frame = +1

Query: 13 PENPILPESTPAPVPNPFEFRKFPQTFPEPVPEPE 117
PE PE P P P P E P+ PEP PEPE
Sbjct: 250 PEPEPEPEPEPEPEPEP-EPEPEPEPEPEPEPEPE 283



Score = 31.2 bits (69), Expect = 2.8
Identities = 17/35 (48%), Positives = 18/35 (51%)
Frame = +1

Query: 13 PENPILPESTPAPVPNPFEFRKFPQTFPEPVPEPE 117
PE PE P P P P E P+ PEP PEPE
Sbjct: 252 PEPEPEPEPEPEPEPEP-EPEPEPEPEPEPEPEPE 285



Score = 31.2 bits (69), Expect = 2.8
Identities = 17/35 (48%), Positives = 18/35 (51%)
Frame = +1

Query: 13 PENPILPESTPAPVPNPFEFRKFPQTFPEPVPEPE 117
PE PE P P P P E P+ PEP PEPE
Sbjct: 254 PEPEPEPEPEPEPEPEP-EPEPEPEPEPEPEPEPE 287



Score = 30.8 bits (68), Expect = 3.7
Identities = 17/38 (44%), Positives = 19/38 (50%)
Frame = +1

Query: 13 PENPILPESTPAPVPNPFEFRKFPQTFPEPVPEPESTS 126
PE PE P P P P E P+ PEP P+PE S
Sbjct: 276 PEPEPEPEPEPEPEPEP-EPEPEPEPEPEPEPQPEPES 312


tr_hit_id Q7T036
Definition tr|Q7T036|Q7T036_XENLA XRnf12C OS=Xenopus laevis
Align length 40
Score (bit) 40.0
E-value 0.061
Report
BLASTX 2.2.19 [Nov-02-2008]


Reference: Altschul, Stephen F., Thomas L. Madden, Alejandro A. Schaffer,
Jinghui Zhang, Zheng Zhang, Webb Miller, and David J. Lipman (1997),
"Gapped BLAST and PSI-BLAST: a new generation of protein database search
programs", Nucleic Acids Res. 25:3389-3402.

Query= BP917935|Adiantum capillus-veneris mRNA, clone:
YMU001_000107_E08.
(500 letters)

Database: uniprot_trembl.fasta
7,341,751 sequences; 2,391,615,440 total letters

Searching..................................................done



Score E
Sequences producing significant alignments: (bits) Value

tr|Q7T036|Q7T036_XENLA XRnf12C OS=Xenopus laevis GN=XRnf12C PE=2... 40 0.061
tr|B7ZR09|B7ZR09_XENLA Putative uncharacterized protein OS=Xenop... 40 0.061
tr|Q0S8Z6|Q0S8Z6_RHOSR DNA polymerase III subunit OS=Rhodococcus... 39 0.14
tr|A0YD71|A0YD71_9GAMM Putative uncharacterized protein OS=marin... 39 0.18
tr|B5W9P2|B5W9P2_SPIMA Hemolysin-type calcium-binding region (Fr... 38 0.23
tr|A0YIV8|A0YIV8_9CYAN Putative uncharacterized protein OS=Lyngb... 38 0.23
tr|B2WBX4|B2WBX4_PYRTR Predicted protein OS=Pyrenophora tritici-... 38 0.30
tr|Q5Z037|Q5Z037_NOCFA Putative uncharacterized protein OS=Nocar... 37 0.39
tr|B0BZP0|B0BZP0_ACAM1 Putative uncharacterized protein OS=Acary... 37 0.39
tr|Q1NTM9|Q1NTM9_9DELT TonB-like OS=delta proteobacterium MLMS-1... 37 0.39
tr|A6F4H2|A6F4H2_9ALTE TonB family protein OS=Marinobacter algic... 37 0.39
tr|A2QGT1|A2QGT1_ASPNC Remark: blast hits result from repetitive... 37 0.39
tr|A1TYW0|A1TYW0_MARAV Sporulation domain protein OS=Marinobacte... 37 0.52
tr|B4L6E1|B4L6E1_DROMO GI16351 OS=Drosophila mojavensis GN=GI163... 37 0.52
tr|A9A593|A9A593_NITMS Signal recognition particle-docking prote... 37 0.52
tr|A0PVG0|A0PVG0_MYCUA DNA polymerase III (Subunit gamma/tau) Dn... 37 0.67
tr|Q84W21|Q84W21_ARATH Putative uncharacterized protein At1g6224... 37 0.67
tr|Q54RY2|Q54RY2_DICDI Putative uncharacterized protein OS=Dicty... 37 0.67
tr|A2QIK3|A2QIK3_ASPNC Contig An04c0140, complete genome. OS=Asp... 37 0.67
tr|Q0AMP3|Q0AMP3_MARMM Putative uncharacterized protein OS=Maric... 36 0.88
tr|B2HKE8|B2HKE8_MYCMM DNA polymerase III (Subunit gamma/tau) Dn... 36 0.88
tr|B1XP24|B1XP24_SYNP2 Serine/threonine protein kinase C OS=Syne... 36 0.88
tr|B5W6P6|B5W6P6_SPIMA Na-Ca exchanger/integrin-beta4 OS=Arthros... 36 0.88
tr|Q7XDR3|Q7XDR3_ORYSJ Os10g0455300 protein OS=Oryza sativa subs... 36 0.88
tr|Q17J26|Q17J26_AEDAE Putative uncharacterized protein (Fragmen... 36 0.88
tr|B4GDI3|B4GDI3_DROPE GL10349 OS=Drosophila persimilis GN=GL103... 36 0.88
tr|B8NIU6|B8NIU6_ASPFL Putative uncharacterized protein OS=Asper... 36 0.88
tr|A1CQB2|A1CQB2_ASPCL Putative uncharacterized protein OS=Asper... 36 0.88
tr|B7LZ11|B7LZ11_ECOLX Inner membrane lipoprotein OS=Escherichia... 36 1.1
tr|A0YIM6|A0YIM6_9CYAN Probable aggregation factor core protein ... 36 1.1

>tr|Q7T036|Q7T036_XENLA XRnf12C OS=Xenopus laevis GN=XRnf12C PE=2
SV=1
Length = 825

Score = 40.0 bits (92), Expect = 0.061
Identities = 21/40 (52%), Positives = 26/40 (65%), Gaps = 2/40 (5%)
Frame = +1

Query: 7 NLPENPILPESTPAPVPNPFEFRKFPQTFPEP--VPEPES 120
N+PE +PES P P+P P E P++ PEP VPEPES
Sbjct: 183 NVPEPEAVPESIPEPIPEP-ESVPEPESVPEPESVPEPES 221


>tr|B7ZR09|B7ZR09_XENLA Putative uncharacterized protein OS=Xenopus
laevis PE=2 SV=1
Length = 751

Score = 40.0 bits (92), Expect = 0.061
Identities = 21/40 (52%), Positives = 26/40 (65%), Gaps = 2/40 (5%)
Frame = +1

Query: 7 NLPENPILPESTPAPVPNPFEFRKFPQTFPEP--VPEPES 120
N+PE +PES P P+P P E P++ PEP VPEPES
Sbjct: 183 NVPEPEAVPESIPEPIPEP-ESVPEPESVPEPESVPEPES 221


>tr|Q0S8Z6|Q0S8Z6_RHOSR DNA polymerase III subunit OS=Rhodococcus
sp. (strain RHA1) GN=RHA1_ro04199 PE=4 SV=1
Length = 753

Score = 38.9 bits (89), Expect = 0.14
Identities = 20/41 (48%), Positives = 22/41 (53%)
Frame = +1

Query: 13 PENPILPESTPAPVPNPFEFRKFPQTFPEPVPEPESTSIQE 135
PE +PE TPAP P P P P PVPEPE T + E
Sbjct: 461 PEPTPVPEPTPAPDPEP---APTPAPAPAPVPEPEQTPVPE 498



Score = 33.5 bits (75), Expect = 5.7
Identities = 16/35 (45%), Positives = 18/35 (51%)
Frame = +1

Query: 31 PESTPAPVPNPFEFRKFPQTFPEPVPEPESTSIQE 135
PE P PVP P P PEP P+PE T + E
Sbjct: 439 PEPMPRPVPEPA-----PTPVPEPEPQPEPTPVPE 468



Score = 33.5 bits (75), Expect = 5.7
Identities = 16/34 (47%), Positives = 18/34 (52%)
Frame = +1

Query: 13 PENPILPESTPAPVPNPFEFRKFPQTFPEPVPEP 114
PE +PE TP P P P P+ PEP PEP
Sbjct: 491 PEQTPVPEPTPVPEPTP-----APEPTPEPEPEP 519


>tr|A0YD71|A0YD71_9GAMM Putative uncharacterized protein OS=marine
gamma proteobacterium HTCC2143 GN=GP2143_03598 PE=4 SV=1
Length = 727

Score = 38.5 bits (88), Expect = 0.18
Identities = 20/37 (54%), Positives = 21/37 (56%)
Frame = +1

Query: 13 PENPILPESTPAPVPNPFEFRKFPQTFPEPVPEPEST 123
PE PE TPAP P P E P+ PEP PEPE T
Sbjct: 407 PEPTPEPEPTPAPEPTP-EPEPTPEPTPEPTPEPEPT 442



Score = 35.8 bits (81), Expect = 1.1
Identities = 19/36 (52%), Positives = 20/36 (55%), Gaps = 1/36 (2%)
Frame = +1

Query: 13 PENPILPESTPAPVPNPF-EFRKFPQTFPEPVPEPE 117
PE PE TPAP P P E P+ PEP PEPE
Sbjct: 582 PEPVPTPEPTPAPEPAPAPEPEPAPEPAPEPAPEPE 617



Score = 34.7 bits (78), Expect = 2.6
Identities = 18/35 (51%), Positives = 19/35 (54%)
Frame = +1

Query: 13 PENPILPESTPAPVPNPFEFRKFPQTFPEPVPEPE 117
PE PE TP P P P E P+ PEP PEPE
Sbjct: 423 PEPEPTPEPTPEPTPEP-EPTPEPEPEPEPEPEPE 456



Score = 34.3 bits (77), Expect = 3.3
Identities = 17/33 (51%), Positives = 18/33 (54%)
Frame = +1

Query: 19 NPILPESTPAPVPNPFEFRKFPQTFPEPVPEPE 117
N LPE TPAP P P + P PEP P PE
Sbjct: 570 NITLPEPTPAPTPEPVPTPE-PTPAPEPAPAPE 601



Score = 33.1 bits (74), Expect = 7.4
Identities = 17/35 (48%), Positives = 18/35 (51%)
Frame = +1

Query: 13 PENPILPESTPAPVPNPFEFRKFPQTFPEPVPEPE 117
PE PE TP P P P P+ PEP PEPE
Sbjct: 419 PEPTPEPEPTPEPTPEP---TPEPEPTPEPEPEPE 450



Score = 32.7 bits (73), Expect = 9.7
Identities = 17/42 (40%), Positives = 19/42 (45%), Gaps = 3/42 (7%)
Frame = +1

Query: 13 PENPILPESTPAPVPNPF---EFRKFPQTFPEPVPEPESTSI 129
PE PE P P P P E P+ PEP PEP S +
Sbjct: 600 PEPEPAPEPAPEPAPEPEPEPEPEPTPEPTPEPTPEPVSVDV 641


>tr|B5W9P2|B5W9P2_SPIMA Hemolysin-type calcium-binding region
(Fragment) OS=Arthrospira maxima CS-328 GN=AmaxDRAFT_5492
PE=4 SV=1
Length = 1313

Score = 38.1 bits (87), Expect = 0.23
Identities = 20/44 (45%), Positives = 23/44 (52%)
Frame = +1

Query: 13 PENPILPESTPAPVPNPFEFRKFPQTFPEPVPEPESTSIQEFLL 144
PE LPE TP P P P P+ PEP P PE T EF++
Sbjct: 1233 PEPEPLPEPTPEPTPEP-----TPEPTPEPEPLPEPTPEPEFVI 1271



Score = 35.8 bits (81), Expect = 1.1
Identities = 20/37 (54%), Positives = 21/37 (56%), Gaps = 1/37 (2%)
Frame = +1

Query: 10 LPENPILPESTPAPVPNPF-EFRKFPQTFPEPVPEPE 117
LPE LPE TP P P P E P+ PEP PEPE
Sbjct: 1198 LPEP--LPEPTPEPTPEPTPEPTPEPEPLPEPTPEPE 1232



Score = 35.4 bits (80), Expect = 1.5
Identities = 17/34 (50%), Positives = 18/34 (52%)
Frame = +1

Query: 13 PENPILPESTPAPVPNPFEFRKFPQTFPEPVPEP 114
PE LPE TP P P P P+ PEP PEP
Sbjct: 1219 PEPEPLPEPTPEPEPEP---EPLPEPTPEPTPEP 1249



Score = 35.0 bits (79), Expect = 2.0
Identities = 17/35 (48%), Positives = 19/35 (54%)
Frame = +1

Query: 13 PENPILPESTPAPVPNPFEFRKFPQTFPEPVPEPE 117
PE LPE P P+P P P+ PEP PEPE
Sbjct: 1189 PEPEPLPEPLPEPLPEPTP-EPTPEPTPEPTPEPE 1222



Score = 33.9 bits (76), Expect = 4.4
Identities = 17/36 (47%), Positives = 19/36 (52%)
Frame = +1

Query: 10 LPENPILPESTPAPVPNPFEFRKFPQTFPEPVPEPE 117
LPE PE P P+P P P+ PEP PEPE
Sbjct: 1224 LPEPTPEPEPEPEPLPEPTP-EPTPEPTPEPTPEPE 1258


>tr|A0YIV8|A0YIV8_9CYAN Putative uncharacterized protein OS=Lyngbya
sp. PCC 8106 GN=L8106_01552 PE=4 SV=1
Length = 1332

Score = 38.1 bits (87), Expect = 0.23
Identities = 19/37 (51%), Positives = 21/37 (56%)
Frame = +1

Query: 13 PENPILPESTPAPVPNPFEFRKFPQTFPEPVPEPEST 123
PE PE TP PVP P E P+ PEP+P PE T
Sbjct: 975 PEPVPTPEPTPEPVPTP-EPEPTPEPTPEPIPTPEPT 1010


>tr|B2WBX4|B2WBX4_PYRTR Predicted protein OS=Pyrenophora
tritici-repentis (strain Pt-1C-BFP) GN=PTRG_07137 PE=4
SV=1
Length = 393

Score = 37.7 bits (86), Expect = 0.30
Identities = 28/79 (35%), Positives = 37/79 (46%), Gaps = 5/79 (6%)
Frame = +1

Query: 31 PESTPAPVPNP-FEFRKFPQTFPEPVPEPESTSIQEFLLRRNHAKFSGRRWSI*RCPYAY 207
P STP P P P F F FP FP P P+P +T + + S R+S+ +
Sbjct: 207 PSSTPKPPPPPHFPFPPFPFPFPLPGPKPTTT-------KAPYVSLSPPRYSV---SWDL 256

Query: 208 QGAN----GHTFHKPRITS 252
Q N HT H+P+ TS
Sbjct: 257 QQRNPPPPPHTPHRPKTTS 275


>tr|Q5Z037|Q5Z037_NOCFA Putative uncharacterized protein OS=Nocardia
farcinica GN=NFA_13590 PE=4 SV=1
Length = 444

Score = 37.4 bits (85), Expect = 0.39
Identities = 20/45 (44%), Positives = 22/45 (48%)
Frame = +1

Query: 1 RRNLPENPILPESTPAPVPNPFEFRKFPQTFPEPVPEPESTSIQE 135
R +P P PE+ PAP P P Q PEP PEPE S E
Sbjct: 329 RAEVPSPPPAPETPPAPEPAP-------QPAPEPAPEPEPESAPE 366



Score = 34.7 bits (78), Expect = 2.6
Identities = 19/41 (46%), Positives = 19/41 (46%)
Frame = +1

Query: 13 PENPILPESTPAPVPNPFEFRKFPQTFPEPVPEPESTSIQE 135
PE PE PAP P P P PEP PEPE QE
Sbjct: 359 PEPESAPEPAPAPEPAP---EPEPAPAPEPAPEPEPAPPQE 396


>tr|B0BZP0|B0BZP0_ACAM1 Putative uncharacterized protein
OS=Acaryochloris marina (strain MBIC 11017) GN=AM1_0924
PE=4 SV=1
Length = 988

Score = 37.4 bits (85), Expect = 0.39
Identities = 18/35 (51%), Positives = 19/35 (54%)
Frame = +1

Query: 13 PENPILPESTPAPVPNPFEFRKFPQTFPEPVPEPE 117
PE P PE TP P P P P+ PEP PEPE
Sbjct: 629 PEQPPTPEPTPEPEPGP-----DPEPEPEPAPEPE 658



Score = 36.2 bits (82), Expect = 0.88
Identities = 19/41 (46%), Positives = 21/41 (51%)
Frame = +1

Query: 13 PENPILPESTPAPVPNPFEFRKFPQTFPEPVPEPESTSIQE 135
PE PE +PAP P P P+ PEP P PE T I E
Sbjct: 651 PEPAPEPEPSPAPTPEP---EPTPEPAPEPEPAPEPTPIPE 688



Score = 33.9 bits (76), Expect = 4.4
Identities = 17/35 (48%), Positives = 19/35 (54%)
Frame = +1

Query: 31 PESTPAPVPNPFEFRKFPQTFPEPVPEPESTSIQE 135
PE PAP P P + P+ PEP PEPE T E
Sbjct: 675 PEPEPAPEPTPIPEPE-PEPTPEPSPEPEPTPTPE 708



Score = 33.9 bits (76), Expect = 4.4
Identities = 17/35 (48%), Positives = 19/35 (54%)
Frame = +1

Query: 31 PESTPAPVPNPFEFRKFPQTFPEPVPEPESTSIQE 135
PE +PAP P P E P+ P P PEPE T E
Sbjct: 717 PEPSPAPTPEP-EPEPTPEPGPAPPPEPEPTPTPE 750



Score = 33.1 bits (74), Expect = 7.4
Identities = 17/35 (48%), Positives = 19/35 (54%)
Frame = +1

Query: 13 PENPILPESTPAPVPNPFEFRKFPQTFPEPVPEPE 117
PE PE PAP P P E P+ P+P PEPE
Sbjct: 727 PEPEPTPEPGPAPPPEP-EPTPTPEPDPDPTPEPE 760


>tr|Q1NTM9|Q1NTM9_9DELT TonB-like OS=delta proteobacterium MLMS-1
GN=MldDRAFT_4549 PE=4 SV=1
Length = 281

Score = 37.4 bits (85), Expect = 0.39
Identities = 19/35 (54%), Positives = 20/35 (57%)
Frame = +1

Query: 13 PENPILPESTPAPVPNPFEFRKFPQTFPEPVPEPE 117
PE P PE P PVP P E P+ PEP PEPE
Sbjct: 74 PEQPPKPEPEPTPVP-PAEPEPEPEPEPEPEPEPE 107