BP917971
Clone id YMU001_000108_A09
Library
Length 477
Definition Adiantum capillus-veneris mRNA. clone: YMU001_000108_A09.
Accession
Tissue type prothallium
Developmental stage -
Contig ID
Sequence
ATCAGCATCATCACTTGAACTCCCAGCCGAGAAGAACTCATCCTCGCTCAAATCTATCGC
TCCATCATCCTCACTTCCCGTTTCTTCTGGCTCCACTCCAGCAGCTGCAGCAGCAGCAAG
ATTGGCCTTTATTTGGTCCCTCAATTTATTTCTTTGATCAACTATAACCTGATCATCACC
ACCCGTGAACAAAGAAACATACTTCTCGGTTTTTGGAAAGAATCGTACATACTCCAGGTC
TTCCTTAAGTTGTCCAAGTTTCTGTGCCATATCTGCAGCCTGTCGGGTGGAATCTTCAGC
TGGATTATCAGCTGCTGCTCTTTGAAATCTCTCAAGTCTCCTAATAGCTCTTTCAATCTT
TCTCCTTTCAAAGAACTTGACTTTGCGGTATCGGAGTGCCATCTTTCTTTCAAGTTCAGC
ATGTGAATGTAACTCTGCTTGTCTCTTTAAATCCTCCAGTCTCCTTTGCTGGGCATC
■■Homology search results ■■ -
sp_hit_id Q5K724
Definition sp|Q5K724|EFG1P_CRYNE rRNA-processing protein EFG1 OS=Cryptococcus neoformans
Align length 100
Score (bit) 65.5
E-value 1.0e-10
Report
BLASTX 2.2.19 [Nov-02-2008]


Reference: Altschul, Stephen F., Thomas L. Madden, Alejandro A. Schaffer,
Jinghui Zhang, Zheng Zhang, Webb Miller, and David J. Lipman (1997),
"Gapped BLAST and PSI-BLAST: a new generation of protein database search
programs", Nucleic Acids Res. 25:3389-3402.

Query= BP917971|Adiantum capillus-veneris mRNA, clone:
YMU001_000108_A09.
(477 letters)

Database: uniprot_sprot.fasta
412,525 sequences; 148,809,765 total letters

Searching..................................................done



Score E
Sequences producing significant alignments: (bits) Value

sp|Q5K724|EFG1P_CRYNE rRNA-processing protein EFG1 OS=Cryptococc... 65 1e-10
sp|Q09867|EFG1P_SCHPO rRNA-processing protein efg1 OS=Schizosacc... 64 5e-10
sp|A8N5J5|EFG1P_COPC7 rRNA-processing protein EFG1 OS=Coprinopsi... 62 1e-09
sp|A5E2Z7|EFG1P_LODEL rRNA-processing protein EFG1 OS=Lodderomyc... 55 1e-07
sp|Q6FTQ8|EFG1P_CANGA rRNA-processing protein EFG1 OS=Candida gl... 55 2e-07
sp|Q4PFU7|EFG1P_USTMA rRNA-processing protein EFG1 OS=Ustilago m... 54 4e-07
sp|Q3E705|EFG1P_YEAST rRNA-processing protein EFG1 OS=Saccharomy... 54 5e-07
sp|A6ZUS8|EFG1P_YEAS7 rRNA-processing protein EFG1 OS=Saccharomy... 54 5e-07
sp|A7TMK6|EFG1P_VANPO rRNA-processing protein EFG1 OS=Vanderwalt... 53 8e-07
sp|Q5AK42|EFG1P_CANAL rRNA-processing protein EFG1 OS=Candida al... 52 1e-06
sp|A5DID3|EFG1P_PICGU rRNA-processing protein EFG1 OS=Pichia gui... 52 2e-06
sp|Q6BH91|EFG1P_DEBHA rRNA-processing protein EFG1 OS=Debaryomyc... 51 2e-06
sp|A3LNR4|EFG1P_PICST rRNA-processing protein EFG1 OS=Pichia sti... 50 4e-06
sp|Q2UEF7|EFG1P_ASPOR rRNA-processing protein efg1 OS=Aspergillu... 50 5e-06
sp|Q75D81|EFG1P_ASHGO rRNA-processing protein EFG1 OS=Ashbya gos... 50 5e-06
sp|A6RVU0|EFG1P_BOTFB rRNA-processing protein efg1 OS=Botryotini... 49 1e-05
sp|Q0C9M9|EFG1P_ASPTN rRNA-processing protein efg1 OS=Aspergillu... 49 1e-05
sp|Q1E0G9|EFG1P_COCIM rRNA-processing protein EFG1 OS=Coccidioid... 48 3e-05
sp|Q2H6A9|EFG1P_CHAGB rRNA-processing protein EFG1 OS=Chaetomium... 47 4e-05
sp|A7EPT0|EFG1P_SCLS1 rRNA-processing protein efg1 OS=Sclerotini... 47 6e-05
sp|Q7RYN6|EFG1P_NEUCR rRNA-processing protein efg-1 OS=Neurospor... 46 1e-04
sp|Q0U913|EFG1P_PHANO rRNA-processing protein EFG1 OS=Phaeosphae... 45 1e-04
sp|Q6CXA6|EFG1P_KLULA rRNA-processing protein EFG1 OS=Kluyveromy... 45 1e-04
sp|Q6CFG6|EFG1P_YARLI rRNA-processing protein EFG1 OS=Yarrowia l... 45 2e-04
sp|A2QNW5|EFG1P_ASPNC rRNA-processing protein efg1 OS=Aspergillu... 45 2e-04
sp|Q5B4J6|EFG1P_EMENI rRNA-processing protein efg1 OS=Emericella... 43 8e-04
sp|A6RBE9|EFG1P_AJECN rRNA-processing protein EFG1 OS=Ajellomyce... 43 8e-04
sp|A4RMA9|EFG1P_MAGGR rRNA-processing protein EFG1 OS=Magnaporth... 42 0.001
sp|A1CF47|EFG1P_ASPCL rRNA-processing protein efg1 OS=Aspergillu... 42 0.001
sp|Q4WI71|EFG1P_ASPFU rRNA-processing protein efg1 OS=Aspergillu... 40 0.007

>sp|Q5K724|EFG1P_CRYNE rRNA-processing protein EFG1 OS=Cryptococcus
neoformans GN=EFG1 PE=3 SV=2
Length = 286

Score = 65.5 bits (158), Expect = 1e-10
Identities = 37/100 (37%), Positives = 58/100 (58%)
Frame = -1

Query: 468 QRRLEDLKRQAELHSHAELERKMALRYRKVKFFERRKIERAIRRLERFQRAAADNPAEDS 289
QRRL L+ E+ERK +Y KVKFFER+K+ +R ++RF+R D +E S
Sbjct: 81 QRRLTSLEADLAAAERREVERKNGAKYHKVKFFERQKL---VRLIKRFKRKLLD--SETS 135

Query: 288 TRQAADMAQKLGQLKEDLEYVRFFPKTEKYVSLFTGGDDQ 169
+++ + ++L + L YV +P T+KY+SLF +Q
Sbjct: 136 SKKRSKHEEELLDARIMLNYVLHYPNTQKYISLFPSNPNQ 175


>sp|Q09867|EFG1P_SCHPO rRNA-processing protein efg1
OS=Schizosaccharomyces pombe GN=efg1 PE=2 SV=2
Length = 183

Score = 63.5 bits (153), Expect = 5e-10
Identities = 35/109 (32%), Positives = 62/109 (56%)
Frame = -1

Query: 468 QRRLEDLKRQAELHSHAELERKMALRYRKVKFFERRKIERAIRRLERFQRAAADNPAEDS 289
+R L L+ Q + ++K+ RY+KV+FFER+K ER I++LE ++ D +D
Sbjct: 37 ERALLGLQEQLSMAQLEHKKQKIFERYKKVRFFERKKAERRIKQLE---KSLKDETMDDE 93

Query: 288 TRQAADMAQKLGQLKEDLEYVRFFPKTEKYVSLFTGGDDQVIVDQRNKL 142
R+ + + + Q+ DL Y++ +P KYVSL+ G + + RN++
Sbjct: 94 KRKQCEKSMRKCQI--DLMYIKEYPPLTKYVSLYAEGTSEQTEETRNRI 140


>sp|A8N5J5|EFG1P_COPC7 rRNA-processing protein EFG1 OS=Coprinopsis
cinerea (strain Okayama-7 / 130 / FGSC 9003) GN=EFG1
PE=3 SV=1
Length = 265

Score = 62.0 bits (149), Expect = 1e-09
Identities = 33/94 (35%), Positives = 57/94 (60%)
Frame = -1

Query: 468 QRRLEDLKRQAELHSHAELERKMALRYRKVKFFERRKIERAIRRLERFQRAAADNPAEDS 289
+RRL+ L+ + + A ER +A+RY KVKFFER+K+ R + +++R +A + E
Sbjct: 68 ERRLKALEAELQQVEQAHKERALAIRYHKVKFFERQKVTRKLNQVKRRLDSADGSEKE-- 125

Query: 288 TRQAADMAQKLGQLKEDLEYVRFFPKTEKYVSLF 187
+ +L + + +L Y+ +PKT+KY+SLF
Sbjct: 126 -----QLEAQLLEERVNLNYILHYPKTKKYISLF 154


>sp|A5E2Z7|EFG1P_LODEL rRNA-processing protein EFG1 OS=Lodderomyces
elongisporus GN=EFG1 PE=3 SV=1
Length = 235

Score = 55.5 bits (132), Expect = 1e-07
Identities = 34/108 (31%), Positives = 58/108 (53%)
Frame = -1

Query: 468 QRRLEDLKRQAELHSHAELERKMALRYRKVKFFERRKIERAIRRLERFQRAAADNPAEDS 289
+R L+ L+ + + E++ A +Y V+FFER+K R +++L + Q N AE S
Sbjct: 56 ERALKGLQVELQNSQKNLKEKENASKYHMVRFFERKKATRKLKQLRK-QFDEMQNTAEPS 114

Query: 288 TRQAADMAQKLGQLKEDLEYVRFFPKTEKYVSLFTGGDDQVIVDQRNK 145
++ + +++ + DL YV FPK EKY+SL+ + I D K
Sbjct: 115 KKELKKLRKQVKHGEIDLLYVCLFPKAEKYISLYPSQSAEDINDPNVK 162


>sp|Q6FTQ8|EFG1P_CANGA rRNA-processing protein EFG1 OS=Candida
glabrata GN=EFG1 PE=3 SV=1
Length = 229

Score = 55.1 bits (131), Expect = 2e-07
Identities = 37/121 (30%), Positives = 61/121 (50%), Gaps = 3/121 (2%)
Frame = -1

Query: 471 QQRRLEDLKRQAELHSHAELERKMALRYRKVKFFERRKIERAIRRLERFQRAAADNPAED 292
++R LE L+ + H E RK A +Y V+FFER+K L R+++A A++
Sbjct: 57 KERTLEALRLELHNHEVKENIRKNAKKYHMVRFFERKK------ALRRYKKALKTYKADE 110

Query: 291 STRQAADMAQKLGQLKEDLEYVRFFPKTEKYVSLFTGGDDQVIVD---QRNKLRDQIKAN 121
+ + L + DL YV FPK+EKY+S+FT D + + +R R ++
Sbjct: 111 NEAN----KEALENAEVDLCYVVNFPKSEKYISIFTEDDTEASAETNLRRKAFRQLVRGK 166

Query: 120 L 118
+
Sbjct: 167 I 167


>sp|Q4PFU7|EFG1P_USTMA rRNA-processing protein EFG1 OS=Ustilago
maydis GN=EFG1 PE=3 SV=1
Length = 341

Score = 53.9 bits (128), Expect = 4e-07
Identities = 38/122 (31%), Positives = 62/122 (50%), Gaps = 23/122 (18%)
Frame = -1

Query: 468 QRRLEDLKRQAELHSHAELERKMALRYRKVKFFERRKIERAIRRLER-FQRAAADNPAE- 295
+RRL+ L+ E+ S ++E+ A RY +VKF ER+K+ R I R +R R +D A+
Sbjct: 96 ERRLKSLESDLEVASRKQVEKSRASRYHRVKFVERQKLVRRIARCKRNLARLNSDKAAQD 155

Query: 294 -DSTRQAAD--------------------MAQKLGQLKEDLEYVRFFPKTEKYVSLFTGG 178
DS +A+D + + L L+E L+YV +P +YV+LF
Sbjct: 156 LDSEGEASDDDDEGYGNQRLKESKMSKEELTKMLRWLRELLQYVMQYPADLRYVALFPTA 215

Query: 177 DD 172
++
Sbjct: 216 EE 217


>sp|Q3E705|EFG1P_YEAST rRNA-processing protein EFG1 OS=Saccharomyces
cerevisiae GN=EFG1 PE=1 SV=2
Length = 233

Score = 53.5 bits (127), Expect = 5e-07
Identities = 37/116 (31%), Positives = 62/116 (53%), Gaps = 3/116 (2%)
Frame = -1

Query: 471 QQRRLEDLKRQAELHSHAELERKMALRYRKVKFFERRKIERAIRRLERFQRAAADNPAED 292
++R L+ L+ + + + + A +Y V+FFE++K A+R+ R + ++ A+D
Sbjct: 55 KERNLQALRLELQNNELKNKIKANAKKYHMVRFFEKKK---ALRKYNRLLKKIKESGADD 111

Query: 291 STRQAADMAQKLGQLKEDLEYVRFFPKTEKYVSLF---TGGDDQVIVDQRNKLRDQ 133
D+ QKL K +L YV FPKTEKY++L+ T D V+ N R+Q
Sbjct: 112 K-----DLQQKLRATKIELCYVINFPKTEKYIALYPNDTPSTDPKGVELTNLRREQ 162


>sp|A6ZUS8|EFG1P_YEAS7 rRNA-processing protein EFG1 OS=Saccharomyces
cerevisiae (strain YJM789) GN=EFG1 PE=3 SV=1
Length = 233

Score = 53.5 bits (127), Expect = 5e-07
Identities = 37/116 (31%), Positives = 62/116 (53%), Gaps = 3/116 (2%)
Frame = -1

Query: 471 QQRRLEDLKRQAELHSHAELERKMALRYRKVKFFERRKIERAIRRLERFQRAAADNPAED 292
++R L+ L+ + + + + A +Y V+FFE++K A+R+ R + ++ A+D
Sbjct: 55 KERNLQALRLELQNNELKNKIKANAKKYHMVRFFEKKK---ALRKYNRLLKKIKESGADD 111

Query: 291 STRQAADMAQKLGQLKEDLEYVRFFPKTEKYVSLF---TGGDDQVIVDQRNKLRDQ 133
D+ QKL K +L YV FPKTEKY++L+ T D V+ N R+Q
Sbjct: 112 K-----DLQQKLRATKIELCYVINFPKTEKYIALYPNDTPSTDPKGVELTNLRREQ 162


>sp|A7TMK6|EFG1P_VANPO rRNA-processing protein EFG1
OS=Vanderwaltozyma polyspora (strain ATCC 22028 / DSM
70294) GN=EFG1 PE=3 SV=1
Length = 230

Score = 52.8 bits (125), Expect = 8e-07
Identities = 34/101 (33%), Positives = 55/101 (54%)
Frame = -1

Query: 471 QQRRLEDLKRQAELHSHAELERKMALRYRKVKFFERRKIERAIRRLERFQRAAADNPAED 292
++R L+ LK + E ++ +K A +Y V+FFER+K A+RR ++ + D P
Sbjct: 56 KERTLDALKLELENAKVRQVIKKNAKKYHMVRFFERKK---ALRRYKQAVKDLEDKPENK 112

Query: 291 STRQAADMAQKLGQLKEDLEYVRFFPKTEKYVSLFTGGDDQ 169
+ L + K DL YV FPKTEKY+SL+ +++
Sbjct: 113 K------YIKNLEKSKIDLCYVVNFPKTEKYISLYPVNEEE 147


>sp|Q5AK42|EFG1P_CANAL rRNA-processing protein EFG1 OS=Candida
albicans GN=EFG1 PE=3 SV=1
Length = 237

Score = 52.4 bits (124), Expect = 1e-06
Identities = 32/100 (32%), Positives = 54/100 (54%), Gaps = 1/100 (1%)
Frame = -1

Query: 465 RRLEDLKRQAELHSHAELERKMALRYRKVKFFERRKIERAIRRLER-FQRAAADNPAEDS 289
R L+ LK + + + +A +Y V+FFER+K R ++ L + F+R + +D
Sbjct: 60 RALKGLKVELQNSQVQNKAKVLAKKYHMVRFFERKKAVRKLKNLRKEFERISQTGIRKDI 119

Query: 288 TRQAADMAQKLGQLKEDLEYVRFFPKTEKYVSLFTGGDDQ 169
+ + G++ DL YV FPKTEKY+SL+ +D+
Sbjct: 120 KKARKQLRH--GEI--DLAYVILFPKTEKYISLYPSPNDE 155


tr_hit_id A5BK56
Definition tr|A5BK56|A5BK56_VITVI Putative uncharacterized protein OS=Vitis vinifera
Align length 143
Score (bit) 169.0
E-value 5.0e-41
Report
BLASTX 2.2.19 [Nov-02-2008]


Reference: Altschul, Stephen F., Thomas L. Madden, Alejandro A. Schaffer,
Jinghui Zhang, Zheng Zhang, Webb Miller, and David J. Lipman (1997),
"Gapped BLAST and PSI-BLAST: a new generation of protein database search
programs", Nucleic Acids Res. 25:3389-3402.

Query= BP917971|Adiantum capillus-veneris mRNA, clone:
YMU001_000108_A09.
(477 letters)

Database: uniprot_trembl.fasta
7,341,751 sequences; 2,391,615,440 total letters

Searching..................................................done



Score E
Sequences producing significant alignments: (bits) Value

tr|A5BK56|A5BK56_VITVI Putative uncharacterized protein OS=Vitis... 169 5e-41
tr|A7NWZ4|A7NWZ4_VITVI Chromosome chr5 scaffold_2, whole genome ... 166 7e-40
tr|A9RAY3|A9RAY3_PHYPA Predicted protein OS=Physcomitrella paten... 159 7e-38
tr|Q9FG92|Q9FG92_ARATH Genomic DNA, chromosome 5, P1 clone:MQD19... 155 7e-37
tr|Q67YA7|Q67YA7_ARATH Putative uncharacterized protein At5g4372... 155 7e-37
tr|Q8LFR5|Q8LFR5_ARATH Putative uncharacterized protein OS=Arabi... 154 3e-36
tr|Q94K10|Q94K10_ARATH Putative uncharacterized protein unannota... 151 2e-35
tr|Q681L1|Q681L1_ARATH Putative uncharacterized protein At5g4372... 144 2e-33
tr|Q67ZK3|Q67ZK3_ARATH Putative uncharacterized protein At5g4372... 143 4e-33
tr|Q7Y1H6|Q7Y1H6_ORYSJ Os03g0797700 protein OS=Oryza sativa subs... 140 3e-32
tr|B8ALB3|B8ALB3_ORYSI Putative uncharacterized protein OS=Oryza... 140 3e-32
tr|B4FUL4|B4FUL4_MAIZE Putative uncharacterized protein OS=Zea m... 137 3e-31
tr|Q56X99|Q56X99_ARATH Putative uncharacterized protein At1g0423... 95 2e-18
tr|B4F8F7|B4F8F7_MAIZE Putative uncharacterized protein OS=Zea m... 90 6e-17
tr|Q015G9|Q015G9_OSTTA [S] KOG4484 Uncharacterized conserved pro... 89 1e-16
tr|A4S044|A4S044_OSTLU Predicted protein OS=Ostreococcus lucimar... 85 2e-15
tr|A9V580|A9V580_MONBE Predicted protein OS=Monosiga brevicollis... 69 2e-10
tr|A3ANM8|A3ANM8_ORYSJ Putative uncharacterized protein OS=Oryza... 66 8e-10
tr|B8P1E2|B8P1E2_9APHY Predicted protein OS=Postia placenta Mad-... 59 9e-08
tr|B5VJL4|B5VJL4_YEAS6 YGR272Cp-like protein OS=Saccharomyces ce... 54 5e-06
tr|B3LHX2|B3LHX2_YEAS1 Putative uncharacterized protein OS=Sacch... 54 5e-06
tr|B3S9M5|B3S9M5_TRIAD Predicted protein OS=Trichoplax adhaerens... 51 3e-05
tr|B8NH94|B8NH94_ASPFL Nuclear protein involved in pre-rRNA proc... 50 6e-05
tr|B6QPD8|B6QPD8_PENMA Nuclear protein involved in pre-rRNA proc... 50 7e-05
tr|B2AX31|B2AX31_PODAN Predicted CDS Pa_7_9160 OS=Podospora anse... 48 2e-04
tr|A0E3V6|A0E3V6_PARTE Chromosome undetermined scaffold_77, whol... 48 3e-04
tr|B2VRK1|B2VRK1_PYRTR Putative uncharacterized protein OS=Pyren... 47 4e-04
tr|B6H1R2|B6H1R2_PENCH Pc13g01470 protein OS=Penicillium chrysog... 46 8e-04
tr|B8M6T0|B8M6T0_9EURO Nuclear protein involved in pre-rRNA proc... 44 0.003
tr|B6JVZ7|B6JVZ7_SCHJP Putative uncharacterized protein OS=Schiz... 43 0.007

>tr|A5BK56|A5BK56_VITVI Putative uncharacterized protein OS=Vitis
vinifera GN=VITISV_020767 PE=4 SV=1
Length = 342

Score = 169 bits (429), Expect = 5e-41
Identities = 88/143 (61%), Positives = 111/143 (77%)
Frame = -1

Query: 477 DAQQRRLEDLKRQAELHSHAELERKMALRYRKVKFFERRKIERAIRRLERFQRAAADNPA 298
+AQ+++LE LK+Q E+H+ +ERK+ LR RK+KFFERRKIER IRRLE+ QRAA+
Sbjct: 56 EAQEKKLEGLKKQQEIHTRLAVERKIFLRDRKIKFFERRKIERRIRRLEKQQRAASGQAQ 115

Query: 297 EDSTRQAADMAQKLGQLKEDLEYVRFFPKTEKYVSLFTGGDDQVIVDQRNKLRDQIKANL 118
E A++A++L +LKEDLEYVRFFPKTEKYVSLF GGDD IVD+RN+LR QIKAN+
Sbjct: 116 E------AEVAEQLSKLKEDLEYVRFFPKTEKYVSLFIGGDDTDIVDRRNRLRKQIKANI 169

Query: 117 XXXXXAGVEPEETGSEDDGAIDL 49
+G + EETGSEDDG +DL
Sbjct: 170 IAAAASGKDLEETGSEDDGLLDL 192


>tr|A7NWZ4|A7NWZ4_VITVI Chromosome chr5 scaffold_2, whole genome
shotgun sequence OS=Vitis vinifera GN=GSVIVT00020117001
PE=4 SV=1
Length = 334

Score = 166 bits (419), Expect = 7e-40
Identities = 87/143 (60%), Positives = 108/143 (75%)
Frame = -1

Query: 477 DAQQRRLEDLKRQAELHSHAELERKMALRYRKVKFFERRKIERAIRRLERFQRAAADNPA 298
+AQ+++LE LK+Q E+H+ +ERK+ LR RK+KFFERRKIER IRRLE+ QRAA+
Sbjct: 56 EAQEKKLEGLKKQQEIHTRLAVERKIFLRDRKIKFFERRKIERRIRRLEKQQRAASGQAQ 115

Query: 297 EDSTRQAADMAQKLGQLKEDLEYVRFFPKTEKYVSLFTGGDDQVIVDQRNKLRDQIKANL 118
E A++L +LKEDLEYVRFFPKTEKYVSLF GGDD IVD+RN+LR QIKAN+
Sbjct: 116 E---------AEQLSKLKEDLEYVRFFPKTEKYVSLFIGGDDTDIVDRRNRLRKQIKANI 166

Query: 117 XXXXXAGVEPEETGSEDDGAIDL 49
+G + EETGSEDDG +DL
Sbjct: 167 IAAAASGKDLEETGSEDDGLLDL 189


>tr|A9RAY3|A9RAY3_PHYPA Predicted protein OS=Physcomitrella patens
subsp. patens GN=PHYPADRAFT_110853 PE=4 SV=1
Length = 193

Score = 159 bits (402), Expect = 7e-38
Identities = 82/131 (62%), Positives = 101/131 (77%)
Frame = -1

Query: 477 DAQQRRLEDLKRQAELHSHAELERKMALRYRKVKFFERRKIERAIRRLERFQRAAADNPA 298
+AQ +RLE+LK Q+ H+ AELERKMALRYR+VKFFERRKIER IRR E+ QRA DNP+
Sbjct: 62 EAQLKRLEELKLQSNAHATAELERKMALRYRRVKFFERRKIERRIRRFEKQQRALLDNPS 121

Query: 297 EDSTRQAADMAQKLGQLKEDLEYVRFFPKTEKYVSLFTGGDDQVIVDQRNKLRDQIKANL 118
ED+ Q +A +L QLKEDLEY+RFFPKTEKY+SL+ G DD + +RN+LR++IKANL
Sbjct: 122 EDNETQLTTLADQLHQLKEDLEYIRFFPKTEKYISLYMGMDDPDVKAKRNELRERIKANL 181

Query: 117 XXXXXAGVEPE 85
AG E E
Sbjct: 182 LAAAAAGHELE 192


>tr|Q9FG92|Q9FG92_ARATH Genomic DNA, chromosome 5, P1 clone:MQD19
OS=Arabidopsis thaliana PE=4 SV=1
Length = 345

Score = 155 bits (393), Expect = 7e-37
Identities = 77/138 (55%), Positives = 103/138 (74%)
Frame = -1

Query: 462 RLEDLKRQAELHSHAELERKMALRYRKVKFFERRKIERAIRRLERFQRAAADNPAEDSTR 283
+LEDLK+Q + H+ +ERK+ R RK+KFFERRKIER+IRRLE+ QR ++ + +
Sbjct: 64 KLEDLKKQQDAHARLAVERKIFFRNRKIKFFERRKIERSIRRLEKLQRTSSAHVGD---- 119

Query: 282 QAADMAQKLGQLKEDLEYVRFFPKTEKYVSLFTGGDDQVIVDQRNKLRDQIKANLXXXXX 103
D+A++L +LKEDLEYVRFFPK EKYVSLFTG +D ++++R K+R QIKAN+
Sbjct: 120 --VDIAEQLSKLKEDLEYVRFFPKNEKYVSLFTGAEDSEVIEKRGKMRQQIKANIIVAAA 177

Query: 102 AGVEPEETGSEDDGAIDL 49
+G E EETGSEDDG +DL
Sbjct: 178 SGKELEETGSEDDGLLDL 195


>tr|Q67YA7|Q67YA7_ARATH Putative uncharacterized protein At5g43720
(At5g43720) OS=Arabidopsis thaliana GN=At5g43720 PE=2
SV=1
Length = 329

Score = 155 bits (393), Expect = 7e-37
Identities = 77/138 (55%), Positives = 103/138 (74%)
Frame = -1

Query: 462 RLEDLKRQAELHSHAELERKMALRYRKVKFFERRKIERAIRRLERFQRAAADNPAEDSTR 283
+LEDLK+Q + H+ +ERK+ R RK+KFFERRKIER+IRRLE+ QR ++ + +
Sbjct: 64 KLEDLKKQQDAHARLAVERKIFFRNRKIKFFERRKIERSIRRLEKLQRTSSAHVGD---- 119

Query: 282 QAADMAQKLGQLKEDLEYVRFFPKTEKYVSLFTGGDDQVIVDQRNKLRDQIKANLXXXXX 103
D+A++L +LKEDLEYVRFFPK EKYVSLFTG +D ++++R K+R QIKAN+
Sbjct: 120 --VDIAEQLSKLKEDLEYVRFFPKNEKYVSLFTGAEDSEVIEKRGKMRQQIKANIIVAAA 177

Query: 102 AGVEPEETGSEDDGAIDL 49
+G E EETGSEDDG +DL
Sbjct: 178 SGKELEETGSEDDGLLDL 195


>tr|Q8LFR5|Q8LFR5_ARATH Putative uncharacterized protein
OS=Arabidopsis thaliana PE=2 SV=1
Length = 328

Score = 154 bits (388), Expect = 3e-36
Identities = 76/138 (55%), Positives = 102/138 (73%)
Frame = -1

Query: 462 RLEDLKRQAELHSHAELERKMALRYRKVKFFERRKIERAIRRLERFQRAAADNPAEDSTR 283
+LEDLK+Q + H+ +ERK+ R RK+KFFERRKIER+IR LE+ QR ++ + +
Sbjct: 64 KLEDLKKQQDAHARLAVERKIFFRNRKIKFFERRKIERSIRHLEKLQRTSSAHVGD---- 119

Query: 282 QAADMAQKLGQLKEDLEYVRFFPKTEKYVSLFTGGDDQVIVDQRNKLRDQIKANLXXXXX 103
D+A++L +LKEDLEYVRFFPK EKYVSLFTG +D ++++R K+R QIKAN+
Sbjct: 120 --VDIAEQLSKLKEDLEYVRFFPKNEKYVSLFTGAEDSEVIEKRGKMRQQIKANIIVAAA 177

Query: 102 AGVEPEETGSEDDGAIDL 49
+G E EETGSEDDG +DL
Sbjct: 178 SGKELEETGSEDDGLLDL 195


>tr|Q94K10|Q94K10_ARATH Putative uncharacterized protein unannotated
coding sequence from BAC F19P19 (At1g04230)
OS=Arabidopsis thaliana GN=At1g04230 PE=2 SV=1
Length = 325

Score = 151 bits (381), Expect = 2e-35
Identities = 77/143 (53%), Positives = 104/143 (72%)
Frame = -1

Query: 477 DAQQRRLEDLKRQAELHSHAELERKMALRYRKVKFFERRKIERAIRRLERFQRAAADNPA 298
+A +++L+DLK+Q ++H ERK+ LR RKV+FFERRKIER+IRRLE+ R+ +
Sbjct: 59 EALEKKLDDLKKQQDIHFRLAFERKIFLRNRKVRFFERRKIERSIRRLEKLHRSTSGGYV 118

Query: 297 EDSTRQAADMAQKLGQLKEDLEYVRFFPKTEKYVSLFTGGDDQVIVDQRNKLRDQIKANL 118
+D A++ +L +LKEDLEYVRFFPK EKYVSLF+G DD + ++R+KLR QIKAN+
Sbjct: 119 QD-----AEIGGQLNRLKEDLEYVRFFPKNEKYVSLFSGSDDLQVSERRSKLRKQIKANI 173

Query: 117 XXXXXAGVEPEETGSEDDGAIDL 49
+G E EETGSEDD +DL
Sbjct: 174 IFAAASGKELEETGSEDDALLDL 196


>tr|Q681L1|Q681L1_ARATH Putative uncharacterized protein At5g43720
OS=Arabidopsis thaliana GN=At5g43720 PE=2 SV=1
Length = 215

Score = 144 bits (364), Expect = 2e-33
Identities = 72/131 (54%), Positives = 97/131 (74%)
Frame = -1

Query: 462 RLEDLKRQAELHSHAELERKMALRYRKVKFFERRKIERAIRRLERFQRAAADNPAEDSTR 283
+LEDLK+Q + H+ +ERK+ R RK+KFFERRKIER+IRRLE+ QR ++ + +
Sbjct: 64 KLEDLKKQQDAHARLAVERKIFFRNRKIKFFERRKIERSIRRLEKLQRTSSAHVGD---- 119

Query: 282 QAADMAQKLGQLKEDLEYVRFFPKTEKYVSLFTGGDDQVIVDQRNKLRDQIKANLXXXXX 103
D+A++L +LKEDLEYVRFFPK EKYVSLFTG +D ++++R K+R QIKAN+
Sbjct: 120 --VDIAEQLSKLKEDLEYVRFFPKNEKYVSLFTGAEDSEVIEKRGKMRQQIKANIIVAAA 177

Query: 102 AGVEPEETGSE 70
+G E EETGSE
Sbjct: 178 SGKELEETGSE 188


>tr|Q67ZK3|Q67ZK3_ARATH Putative uncharacterized protein At5g43720
OS=Arabidopsis thaliana GN=At5g43720 PE=2 SV=1
Length = 215

Score = 143 bits (361), Expect = 4e-33
Identities = 71/131 (54%), Positives = 96/131 (73%)
Frame = -1

Query: 462 RLEDLKRQAELHSHAELERKMALRYRKVKFFERRKIERAIRRLERFQRAAADNPAEDSTR 283
+LEDLK+Q + H+ +ERK+ R RK+KFFERRKIER++RRLE+ QR ++ + +
Sbjct: 64 KLEDLKKQQDAHARLAVERKIFFRNRKIKFFERRKIERSVRRLEKLQRTSSAHVGD---- 119

Query: 282 QAADMAQKLGQLKEDLEYVRFFPKTEKYVSLFTGGDDQVIVDQRNKLRDQIKANLXXXXX 103
D A++L +LKEDLEYVRFFPK EKYVSLFTG +D ++++R K+R QIKAN+
Sbjct: 120 --VDKAEQLSKLKEDLEYVRFFPKNEKYVSLFTGAEDSEVIEKRGKMRQQIKANIIVAAA 177

Query: 102 AGVEPEETGSE 70
+G E EETGSE
Sbjct: 178 SGKELEETGSE 188


>tr|Q7Y1H6|Q7Y1H6_ORYSJ Os03g0797700 protein OS=Oryza sativa subsp.
japonica GN=OSJNBa0094F01.10 PE=2 SV=1
Length = 318

Score = 140 bits (353), Expect = 3e-32
Identities = 75/137 (54%), Positives = 96/137 (70%)
Frame = -1

Query: 474 AQQRRLEDLKRQAELHSHAELERKMALRYRKVKFFERRKIERAIRRLERFQRAAADNPAE 295
AQ+++LE+LKRQ EL + ++R + LR RK+KFFERRKIER IRRLE+ QR+ AD
Sbjct: 61 AQEKKLEELKRQQELQNQLAIQRTVQLRDRKIKFFERRKIERMIRRLEKQQRSNAD---- 116

Query: 294 DSTRQAADMAQKLGQLKEDLEYVRFFPKTEKYVSLFTGGDDQVIVDQRNKLRDQIKANLX 115
D + KL +LKEDLEYVRFFPK EKYVSLF+GG+ ++++RNK R QIK NL
Sbjct: 117 -------DASNKLSKLKEDLEYVRFFPKNEKYVSLFSGGNTPDMLEKRNKWRKQIKENLM 169

Query: 114 XXXXAGVEPEETGSEDD 64
G + EET S+DD
Sbjct: 170 AAAENGKDLEETASDDD 186