BP918003
Clone id YMU001_000108_E01
Library
Length 548
Definition Adiantum capillus-veneris mRNA. clone: YMU001_000108_E01.
Accession
Tissue type prothallium
Developmental stage -
Contig ID -
Sequence
GTACAATTGGTAGCATGCTGATGTGCCAAGAGTGTGGCTATAAGTTTTCTACTCAGTTCC
AGTCTTTCCATGAAGTGCCCTTGTCGCCGCCACAGTTTTCTAATGGGAACATTGTAAATG
GATGCAACTTAGAGGCCTGTTTAGAGCAGTTTACGGCGCCAGAATGTATTTCAAATGTGA
GGTGCAGTTGCTGTTCGCATTCGCTCGCCCTCCGTCTTCTGGAAAACAGGGGTTTACTGG
ATAAGGCTGTGTTCCAGAGAATTAAAGACTGCACTTTTGATGATGATTGCTCATGCGAGC
AACTTGTGACGCAAATAGGAGGGTCATGGAAAAATGTTCACGTGAATGCAATTAAGCAGT
TGACATTTGGACGTTGTCCGGAGGTAATGCGCTGTCAAGTGCAGCGGGTGGTAGTCAGTT
CTGGGGAGCTAGTTAAATGGACGGGCCATGTGTCATTTCCGCTTGTTTTGAATCTGCAAC
CTTTTGTAATGTTTTCACAAGGTCGCTTTGGGAAACCTTTGTTCAATCAAAGGGGCCAAA
TGAGATGC
■■Homology search results ■■ -
sp_hit_id Q9FPS0
Definition sp|Q9FPS0|UBP27_ARATH Ubiquitin carboxyl-terminal hydrolase 27 OS=Arabidopsis thaliana
Align length 167
Score (bit) 108.0
E-value 2.0e-23
Report
BLASTX 2.2.19 [Nov-02-2008]


Reference: Altschul, Stephen F., Thomas L. Madden, Alejandro A. Schaffer,
Jinghui Zhang, Zheng Zhang, Webb Miller, and David J. Lipman (1997),
"Gapped BLAST and PSI-BLAST: a new generation of protein database search
programs", Nucleic Acids Res. 25:3389-3402.

Query= BP918003|Adiantum capillus-veneris mRNA, clone:
YMU001_000108_E01.
(548 letters)

Database: uniprot_sprot.fasta
412,525 sequences; 148,809,765 total letters

Searching..................................................done



Score E
Sequences producing significant alignments: (bits) Value

sp|Q9FPS0|UBP27_ARATH Ubiquitin carboxyl-terminal hydrolase 27 O... 108 2e-23
sp|Q8K387|UBP45_MOUSE Ubiquitin carboxyl-terminal hydrolase 45 O... 41 0.004
sp|Q9Y5T5|UBP16_HUMAN Ubiquitin carboxyl-terminal hydrolase 16 O... 41 0.004
sp|Q70EL2|UBP45_HUMAN Ubiquitin carboxyl-terminal hydrolase 45 O... 39 0.013
sp|Q9UPT9|UBP22_HUMAN Ubiquitin carboxyl-terminal hydrolase 22 O... 37 0.063
sp|Q5DU02|UBP22_MOUSE Ubiquitin carboxyl-terminal hydrolase 22 O... 37 0.082
sp|Q9QZL6|UBP21_MOUSE Ubiquitin carboxyl-terminal hydrolase 21 O... 34 0.41
sp|Q9UK80|UBP21_HUMAN Ubiquitin carboxyl-terminal hydrolase 21 O... 34 0.41
sp|A6NNY8|UBP27_HUMAN Ubiquitin carboxyl-terminal hydrolase 27 O... 33 1.2
sp|O57429|UBP2_CHICK Ubiquitin carboxyl-terminal hydrolase 2 OS=... 32 1.5
sp|Q9FIQ1|UBP21_ARATH Ubiquitin carboxyl-terminal hydrolase 21 O... 32 1.5
sp|P54767|DCE_SOLLC Glutamate decarboxylase OS=Solanum lycopersi... 31 4.5
sp|O74442|UBP16_SCHPO Probable ubiquitin carboxyl-terminal hydro... 30 5.9
sp|Q9C585|UBP8_ARATH Ubiquitin carboxyl-terminal hydrolase 8 OS=... 30 7.7

>sp|Q9FPS0|UBP27_ARATH Ubiquitin carboxyl-terminal hydrolase 27
OS=Arabidopsis thaliana GN=UBP27 PE=2 SV=1
Length = 494

Score = 108 bits (270), Expect = 2e-23
Identities = 59/167 (35%), Positives = 88/167 (52%), Gaps = 1/167 (0%)
Frame = +3

Query: 6 IGSMLMCQECGYKFSTQFQSFHEVPLSPPQFSNG-NIVNGCNLEACLEQFTAPECISNVR 182
+GS LMC+ C + S +FQ FH +PLSP G NI++GC LE CL++F E + N
Sbjct: 234 LGSTLMCRTCSSQISLEFQFFHTLPLSPLLHHGGYNIMSGCTLEHCLKKFLNTEKVENYF 293

Query: 183 CSCCSHSXXXXXXXXXXXXDKAVFQRIKDCTFDDDCSCEQLVTQIGGSWKNVHVNAIKQL 362
C C H + + ++++ C +D C C+ + W N + + +KQL
Sbjct: 294 CYRCWHGAALKYLSVIGAAETEI-EKLRSCGGEDQCDCKTSLHLQRMPWSNSYSHILKQL 352

Query: 363 TFGRCPEVMRCQVQRVVVSSGELVKWTGHVSFPLVLNLQPFVMFSQG 503
R P+++ QVQR + E K +GH++FPLVLNL F S G
Sbjct: 353 IIARFPKLLCIQVQRASFNMFEEFKLSGHIAFPLVLNLSLFTPSSIG 399


>sp|Q8K387|UBP45_MOUSE Ubiquitin carboxyl-terminal hydrolase 45
OS=Mus musculus GN=Usp45 PE=2 SV=1
Length = 813

Score = 40.8 bits (94), Expect = 0.004
Identities = 31/121 (25%), Positives = 48/121 (39%)
Frame = +3

Query: 123 CNLEACLEQFTAPECISNVRCSCCSHSXXXXXXXXXXXXDKAVFQRIKDCTFDDDCSCEQ 302
C++++CL QFT+ E + C +DCT + C +
Sbjct: 617 CSVQSCLYQFTSMELLMGNNKLLC-----------------------EDCT-EKRRKCHK 652

Query: 303 LVTQIGGSWKNVHVNAIKQLTFGRCPEVMRCQVQRVVVSSGELVKWTGHVSFPLVLNLQP 482
+ V+ NA KQL P ++ ++R + L K HV FPL L+L P
Sbjct: 653 ETSSAEKKAGGVYTNARKQLLISAVPAILILHLKRFHQAGLSLRKVNRHVDFPLTLDLAP 712

Query: 483 F 485
F
Sbjct: 713 F 713


>sp|Q9Y5T5|UBP16_HUMAN Ubiquitin carboxyl-terminal hydrolase 16
OS=Homo sapiens GN=USP16 PE=1 SV=1
Length = 823

Score = 40.8 bits (94), Expect = 0.004
Identities = 30/124 (24%), Positives = 46/124 (37%), Gaps = 3/124 (2%)
Frame = +3

Query: 123 CNLEACLEQFTAPECISNVR---CSCCSHSXXXXXXXXXXXXDKAVFQRIKDCTFDDDCS 293
C+++ CL QFT E + + C C+
Sbjct: 631 CSIQHCLYQFTRNEKLRDANKLLCEVCTRR-----------------------------Q 661

Query: 294 CEQLVTQIGGSWKNVHVNAIKQLTFGRCPEVMRCQVQRVVVSSGELVKWTGHVSFPLVLN 473
C I G K+V+ NA KQ+ P V+ ++R + L K H+ FP +L+
Sbjct: 662 CNGPKANIKGERKHVYTNAKKQMLISLAPPVLTLHLKRFQQAGFNLRKVNKHIKFPEILD 721

Query: 474 LQPF 485
L PF
Sbjct: 722 LAPF 725


>sp|Q70EL2|UBP45_HUMAN Ubiquitin carboxyl-terminal hydrolase 45
OS=Homo sapiens GN=USP45 PE=1 SV=2
Length = 814

Score = 39.3 bits (90), Expect = 0.013
Identities = 33/124 (26%), Positives = 55/124 (44%), Gaps = 3/124 (2%)
Frame = +3

Query: 123 CNLEACLEQFTAPECI---SNVRCSCCSHSXXXXXXXXXXXXDKAVFQRIKDCTFDDDCS 293
C++++CL QFT+ E + + + C C+ + K +Q ++
Sbjct: 618 CSIQSCLYQFTSMELLMGNNKLLCENCTKN-------------KQKYQ-------EETSF 657

Query: 294 CEQLVTQIGGSWKNVHVNAIKQLTFGRCPEVMRCQVQRVVVSSGELVKWTGHVSFPLVLN 473
E+ V + V+ NA KQL P V+ ++R + L K HV FPL+L+
Sbjct: 658 AEKKV-------EGVYTNARKQLLISAVPAVLILHLKRFHQAGLSLRKVNRHVDFPLMLD 710

Query: 474 LQPF 485
L PF
Sbjct: 711 LAPF 714


>sp|Q9UPT9|UBP22_HUMAN Ubiquitin carboxyl-terminal hydrolase 22
OS=Homo sapiens GN=USP22 PE=2 SV=2
Length = 525

Score = 37.0 bits (84), Expect = 0.063
Identities = 48/185 (25%), Positives = 69/185 (37%), Gaps = 22/185 (11%)
Frame = +3

Query: 12 SMLMCQECGYKFSTQFQSFHEV------------PLSPPQFSNGNIVNG-------CNLE 134
S + CQ C + ST F ++ PLSP S GN+VNG L
Sbjct: 307 SDVTCQVC-HGVSTTIDPFWDISLDLPGSSTPFWPLSPG--SEGNVVNGESHVSGTTTLT 363

Query: 135 ACLEQFTAPECISN---VRCSCCSHSXXXXXXXXXXXXDKAVFQRIKDCTFDDDCSCEQL 305
CL +FT PE + + ++CS C HS
Sbjct: 364 DCLRRFTRPEHLGSSAKIKCSGC-HS---------------------------------- 388

Query: 306 VTQIGGSWKNVHVNAIKQLTFGRCPEVMRCQVQRVVVSSGELVKWTGHVSFPLVLNLQPF 485
+ + KQLT + P V ++R S+ K T +VSFPL L++ PF
Sbjct: 389 -----------YQESTKQLTMKKLPIVACFHLKRFEHSAKLRRKITTYVSFPLELDMTPF 437

Query: 486 VMFSQ 500
+ S+
Sbjct: 438 MASSK 442


>sp|Q5DU02|UBP22_MOUSE Ubiquitin carboxyl-terminal hydrolase 22
OS=Mus musculus GN=Usp22 PE=2 SV=2
Length = 525

Score = 36.6 bits (83), Expect = 0.082
Identities = 50/197 (25%), Positives = 75/197 (38%), Gaps = 27/197 (13%)
Frame = +3

Query: 12 SMLMCQECGYKFSTQFQSFHEV------------PLSPPQFSNGNIVNG-------CNLE 134
S + CQ C + ST F ++ PLSP S G++VNG L
Sbjct: 307 SDVTCQVC-HGVSTTIDPFWDISLDLPGSSTPFWPLSPG--SEGSVVNGESHASGTTTLT 363

Query: 135 ACLEQFTAPECISN---VRCSCCSHSXXXXXXXXXXXXDKAVFQRIKDCTFDDDCSCEQL 305
CL +FT PE + + ++CS C HS
Sbjct: 364 DCLRRFTRPEHLGSSAKIKCSGC-HS---------------------------------- 388

Query: 306 VTQIGGSWKNVHVNAIKQLTFGRCPEVMRCQVQRVVVSSGELVKWTGHVSFPLVLNLQPF 485
+ + KQLT + P V ++R S+ K T +VSFPL L++ PF
Sbjct: 389 -----------YQESTKQLTMKKLPIVACFHLKRFEHSAKLRRKITTYVSFPLELDMTPF 437

Query: 486 VMFSQ-----GRFGKPL 521
+ S+ G++ +PL
Sbjct: 438 MASSKESRMNGQYQQPL 454


>sp|Q9QZL6|UBP21_MOUSE Ubiquitin carboxyl-terminal hydrolase 21
OS=Mus musculus GN=Usp21 PE=2 SV=1
Length = 566

Score = 34.3 bits (77), Expect = 0.41
Identities = 41/174 (23%), Positives = 63/174 (36%), Gaps = 3/174 (1%)
Frame = +3

Query: 12 SMLMCQECGYKFSTQFQSFHEVPLSPPQ--FSNGNIVNGCNLEACLEQFTAPECISNVRC 185
S L CQ CGY+ ST F+ F ++ L P+ F+ G + +L C FT E + +
Sbjct: 381 SCLKCQACGYR-STTFEVFCDLSLPIPKKGFAGGKV----SLRDCFSLFTKEEELESENA 435

Query: 186 SCCSHSXXXXXXXXXXXXDKAVFQRIKDCTFDDDCSCEQLVTQIGGSWKNVHVNAIKQLT 365
C C Q + K+LT
Sbjct: 436 PVCDR-------------------------------CRQ------------KTRSTKKLT 452

Query: 366 FGRCPEVMRCQVQRVVVSSGELVKWTGHVSFPLV-LNLQPFVMFSQGRFGKPLF 524
R P ++ + R S G + K + V FPL L+L F+ + G P++
Sbjct: 453 VQRFPRILVLHLNRFSTSRGSIKKSSVGVDFPLQRLSLGD---FASDKAGSPVY 503


>sp|Q9UK80|UBP21_HUMAN Ubiquitin carboxyl-terminal hydrolase 21
OS=Homo sapiens GN=USP21 PE=1 SV=1
Length = 565

Score = 34.3 bits (77), Expect = 0.41
Identities = 41/174 (23%), Positives = 63/174 (36%), Gaps = 3/174 (1%)
Frame = +3

Query: 12 SMLMCQECGYKFSTQFQSFHEVPLSPPQ--FSNGNIVNGCNLEACLEQFTAPECISNVRC 185
S L CQ CGY+ ST F+ F ++ L P+ F+ G + +L C FT E + +
Sbjct: 380 SCLKCQACGYR-STTFEVFCDLSLPIPKKGFAGGKV----SLRDCFNLFTKEEELESENA 434

Query: 186 SCCSHSXXXXXXXXXXXXDKAVFQRIKDCTFDDDCSCEQLVTQIGGSWKNVHVNAIKQLT 365
C C Q + K+LT
Sbjct: 435 PVCDR-------------------------------CRQ------------KTRSTKKLT 451

Query: 366 FGRCPEVMRCQVQRVVVSSGELVKWTGHVSFPLV-LNLQPFVMFSQGRFGKPLF 524
R P ++ + R S G + K + V FPL L+L F+ + G P++
Sbjct: 452 VQRFPRILVLHLNRFSASRGSIKKSSVGVDFPLQRLSLGD---FASDKAGSPVY 502


>sp|A6NNY8|UBP27_HUMAN Ubiquitin carboxyl-terminal hydrolase 27
OS=Homo sapiens GN=USP27X PE=2 SV=2
Length = 559

Score = 32.7 bits (73), Expect = 1.2
Identities = 18/49 (36%), Positives = 28/49 (57%)
Frame = +3

Query: 354 KQLTFGRCPEVMRCQVQRVVVSSGELVKWTGHVSFPLVLNLQPFVMFSQ 500
KQLT + P V +R S+ + K T ++SFPL L++ PF+ S+
Sbjct: 416 KQLTMNKLPVVACFHFKRFEHSAKQRRKITTYISFPLELDMTPFMASSK 464


>sp|O57429|UBP2_CHICK Ubiquitin carboxyl-terminal hydrolase 2
OS=Gallus gallus GN=USP2 PE=2 SV=1
Length = 357

Score = 32.3 bits (72), Expect = 1.5
Identities = 21/62 (33%), Positives = 30/62 (48%), Gaps = 1/62 (1%)
Frame = +3

Query: 12 SMLMCQECGYKFSTQFQSFHEVPLSPPQFSNGNIVNGCNLEACLEQFTAPECI-SNVRCS 188
S L C ECGY ST F F ++ L P+ G + L CL FT + + + + +
Sbjct: 173 SSLTCSECGY-CSTAFDPFWDLSLPIPKKGYGEV----TLMDCLRLFTKEDVLDGDEKPT 227

Query: 189 CC 194
CC
Sbjct: 228 CC 229


tr_hit_id A9RX64
Definition tr|A9RX64|A9RX64_PHYPA Ubiquitin carboxyl-terminal hydrolase OS=Physcomitrella patens subsp. patens
Align length 213
Score (bit) 132.0
E-value 9.0e-30
Report
BLASTX 2.2.19 [Nov-02-2008]


Reference: Altschul, Stephen F., Thomas L. Madden, Alejandro A. Schaffer,
Jinghui Zhang, Zheng Zhang, Webb Miller, and David J. Lipman (1997),
"Gapped BLAST and PSI-BLAST: a new generation of protein database search
programs", Nucleic Acids Res. 25:3389-3402.

Query= BP918003|Adiantum capillus-veneris mRNA, clone:
YMU001_000108_E01.
(548 letters)

Database: uniprot_trembl.fasta
7,341,751 sequences; 2,391,615,440 total letters

Searching..................................................done



Score E
Sequences producing significant alignments: (bits) Value

tr|A9RX64|A9RX64_PHYPA Ubiquitin carboxyl-terminal hydrolase OS=... 132 9e-30
tr|A7PKY6|A7PKY6_VITVI Ubiquitin carboxyl-terminal hydrolase OS=... 115 2e-24
tr|A5B229|A5B229_VITVI Ubiquitin carboxyl-terminal hydrolase OS=... 115 2e-24
tr|Q01LG4|Q01LG4_ORYSA Ubiquitin carboxyl-terminal hydrolase OS=... 110 6e-23
tr|Q0JD65|Q0JD65_ORYSJ Os04g0429200 protein OS=Oryza sativa subs... 108 1e-22
tr|B8ATS8|B8ATS8_ORYSI Putative uncharacterized protein OS=Oryza... 108 1e-22
tr|B4FF77|B4FF77_MAIZE Putative uncharacterized protein OS=Zea m... 106 9e-22
tr|Q7XUT7|Q7XUT7_ORYSA OSJNBa0042L16.10 protein OS=Oryza sativa ... 94 4e-18
tr|A3ATY1|A3ATY1_ORYSJ Putative uncharacterized protein OS=Oryza... 94 4e-18
tr|B6ME74|B6ME74_BRAFL Putative uncharacterized protein OS=Branc... 48 4e-04
tr|Q16LM8|Q16LM8_AEDAE Ubiquitin-specific protease (Fragment) OS... 45 0.002
tr|B6N4C0|B6N4C0_BRAFL Putative uncharacterized protein OS=Branc... 45 0.002
tr|B7S4G7|B7S4G7_PHATR Predicted protein OS=Phaeodactylum tricor... 43 0.012
tr|Q4RFR1|Q4RFR1_TETNG Ubiquitin carboxyl-terminal hydrolase (Fr... 42 0.016
tr|A7RVJ3|A7RVJ3_NEMVE Ubiquitin carboxyl-terminal hydrolase OS=... 42 0.016
tr|B0WUI4|B0WUI4_CULQU Ubiquitin carboxyl-terminal hydrolase OS=... 41 0.036
tr|Q99LG0|Q99LG0_MOUSE Ubiquitin carboxyl-terminal hydrolase OS=... 41 0.047
tr|Q99KM0|Q99KM0_MOUSE Usp16 protein (Fragment) OS=Mus musculus ... 41 0.047
tr|Q16QX8|Q16QX8_AEDAE Putative uncharacterized protein (Fragmen... 41 0.047
tr|Q9H3E6|Q9H3E6_HUMAN Ubiquitin carboxyl-terminal hydrolase OS=... 41 0.047
tr|Q53HA0|Q53HA0_HUMAN Ubiquitin carboxyl-terminal hydrolase (Fr... 41 0.047
tr|Q53GP7|Q53GP7_HUMAN Ubiquitin carboxyl-terminal hydrolase (Fr... 41 0.047
tr|B4DY37|B4DY37_HUMAN cDNA FLJ61461, highly similar to Ubiquiti... 41 0.047
tr|B4DUS4|B4DUS4_HUMAN cDNA FLJ57202, highly similar to Ubiquiti... 41 0.047
tr|B4DFV8|B4DFV8_HUMAN cDNA FLJ57270, highly similar to Ubiquiti... 41 0.047
tr|B3KN13|B3KN13_HUMAN cDNA FLJ13185 fis, clone NT2RP3004209, hi... 41 0.047
tr|B7FVH4|B7FVH4_PHATR Predicted protein OS=Phaeodactylum tricor... 40 0.080
tr|Q4R6X7|Q4R6X7_MACFA Testis cDNA, clone: QtsA-16913, similar t... 40 0.10
tr|Q4R6G7|Q4R6G7_MACFA Testis cDNA, clone: QtsA-18064, similar t... 40 0.10
tr|Q5KPS0|Q5KPS0_CRYNE Putative uncharacterized protein OS=Crypt... 40 0.10

>tr|A9RX64|A9RX64_PHYPA Ubiquitin carboxyl-terminal hydrolase
OS=Physcomitrella patens subsp. patens
GN=PHYPADRAFT_71714 PE=3 SV=1
Length = 812

Score = 132 bits (333), Expect = 9e-30
Identities = 77/213 (36%), Positives = 112/213 (52%), Gaps = 47/213 (22%)
Frame = +3

Query: 3 TIGSMLMCQECGYKFSTQFQSFHEVPLSPPQFSNGNIVNGCNLEACLEQFTAPECISNVR 182
T+GS++ CQ C ++FST FQ F+++ L + ++G+I++ C LE CL++FTAPE +++V+
Sbjct: 243 TLGSLMTCQRCDFQFSTVFQYFNDISLPLSRRTDGSIIDNCTLEDCLDRFTAPEWVASVK 302

Query: 183 CSCCSHSXXXXXXXXXXXX----------DKAVFQR----IKDCTFDDDCSCEQLVTQIG 320
CS C+H D + Q I+DC+ DDDCSCE LV + G
Sbjct: 303 CSHCAHMEASKVLRSQMDNTDLTTDQEQLDVHIIQEKIKIIEDCSCDDDCSCEALVLKQG 362

Query: 321 GSWKNVHVNAIKQLTFGRCPEVMRCQVQRVVVSS-GELVKWT------------------ 443
G W +V NA K+L GR PEV+ QVQR VV+ GEL K +
Sbjct: 363 GVWNSVRTNASKRLRIGRSPEVLCLQVQRAVVNEVGELRKLSVTFHLMSLLVKEIETLFS 422

Query: 444 --------------GHVSFPLVLNLQPFVMFSQ 500
GHV FP++L+L P+ + SQ
Sbjct: 423 VLAVFNYASVQFDVGHVRFPMILDLFPYTVASQ 455


>tr|A7PKY6|A7PKY6_VITVI Ubiquitin carboxyl-terminal hydrolase
OS=Vitis vinifera GN=GSVIVT00019361001 PE=3 SV=1
Length = 506

Score = 115 bits (287), Expect = 2e-24
Identities = 58/167 (34%), Positives = 85/167 (50%), Gaps = 1/167 (0%)
Frame = +3

Query: 6 IGSMLMCQECGYKFSTQFQSFHEVPLSPPQFSNGNIVNGCNLEACLEQFTAPECISNVRC 185
+GS L CQ C ++ + F+ FH + LSP + G I+ GC +E CL QF E + N C
Sbjct: 237 LGSFLTCQSCSFQITLDFEFFHSLSLSPVLNNGGAIMAGCTVEDCLRQFVVAEQVENYHC 296

Query: 186 SCCSHSXXXXXXXXXXXXDKAVFQRIKDCTFDDDCSCEQLVTQIGGSWKNVHVNAIKQLT 365
C H ++A Q+++ C C C L+ W N +KQL+
Sbjct: 297 HSCWH-IAATKYLSLRSGNEAEIQKLRCCREQGSCDCRNLLNLEAVPWSNSFSRTLKQLS 355

Query: 366 FGRCPEVMRCQVQRVVVS-SGELVKWTGHVSFPLVLNLQPFVMFSQG 503
RCP+++ +QR ++ GEL K GH+SFPL+LNL PF+ G
Sbjct: 356 IVRCPKILCIHLQRASMTIFGELTKVQGHISFPLILNLLPFMKSEVG 402


>tr|A5B229|A5B229_VITVI Ubiquitin carboxyl-terminal hydrolase
OS=Vitis vinifera GN=VITISV_026074 PE=3 SV=1
Length = 559

Score = 115 bits (287), Expect = 2e-24
Identities = 58/167 (34%), Positives = 85/167 (50%), Gaps = 1/167 (0%)
Frame = +3

Query: 6 IGSMLMCQECGYKFSTQFQSFHEVPLSPPQFSNGNIVNGCNLEACLEQFTAPECISNVRC 185
+GS L CQ C ++ + F+ FH + LSP + G I+ GC +E CL QF E + N C
Sbjct: 182 LGSFLTCQSCSFQITLDFEFFHSLSLSPVLNNGGAIMAGCTVEDCLRQFVVAEQVENYHC 241

Query: 186 SCCSHSXXXXXXXXXXXXDKAVFQRIKDCTFDDDCSCEQLVTQIGGSWKNVHVNAIKQLT 365
C H ++A Q+++ C C C L+ W N +KQL+
Sbjct: 242 HSCWH-IAATKYLSLRSGNEAEIQKLRCCREQGSCDCRNLLNLEAVPWSNSFSRTLKQLS 300

Query: 366 FGRCPEVMRCQVQRVVVS-SGELVKWTGHVSFPLVLNLQPFVMFSQG 503
RCP+++ +QR ++ GEL K GH+SFPL+LNL PF+ G
Sbjct: 301 IVRCPKILCIHLQRASMTIFGELTKVQGHISFPLILNLLPFMKSEVG 347


>tr|Q01LG4|Q01LG4_ORYSA Ubiquitin carboxyl-terminal hydrolase
OS=Oryza sativa GN=OSIGBa0093L02.3 PE=3 SV=1
Length = 538

Score = 110 bits (274), Expect = 6e-23
Identities = 60/162 (37%), Positives = 86/162 (53%), Gaps = 1/162 (0%)
Frame = +3

Query: 3 TIGSMLMCQECGYKFSTQFQSFHEVPLSPPQFSNGNIVNGCNLEACLEQFTAPECISNVR 182
TIGS+L C+ C S F++F+ +PLSP NG+I+NGC+L CLE FTA E + N R
Sbjct: 218 TIGSILSCRNCSSVLSLDFENFYCLPLSPVATINGDIINGCSLVDCLEHFTALEHLDNYR 277

Query: 183 CSCCSHSXXXXXXXXXXXXDKAVFQRIKDCTFDDDCSCEQLVTQIGGSWKNVHVNAIKQL 362
C C H+ D+ +++ C CSC + T + ++ A KQL
Sbjct: 278 CDHCWHNVAAKYLSLKSEVDEEKINKLRTCVDYGTCSCRHIFTPEEMTC-SISSQATKQL 336

Query: 363 TFGRCPEVMRCQVQRVVVS-SGELVKWTGHVSFPLVLNLQPF 485
P+++ + R V GE VK GH+SFPL+L+L PF
Sbjct: 337 AITHFPKILCIHLLRASVGLDGEFVKRGGHISFPLLLDLSPF 378


>tr|Q0JD65|Q0JD65_ORYSJ Os04g0429200 protein OS=Oryza sativa subsp.
japonica GN=Os04g0429200 PE=4 SV=1
Length = 381

Score = 108 bits (271), Expect = 1e-22
Identities = 60/162 (37%), Positives = 85/162 (52%), Gaps = 1/162 (0%)
Frame = +3

Query: 3 TIGSMLMCQECGYKFSTQFQSFHEVPLSPPQFSNGNIVNGCNLEACLEQFTAPECISNVR 182
TIGS+L C+ C S F++F+ +PLSP NG+I+NGC+L CLE FTA E + N R
Sbjct: 151 TIGSILSCRNCSSVLSLDFENFYCLPLSPVATINGDIINGCSLVDCLEHFTALEHLDNYR 210

Query: 183 CSCCSHSXXXXXXXXXXXXDKAVFQRIKDCTFDDDCSCEQLVTQIGGSWKNVHVNAIKQL 362
C C H+ D+ ++ C CSC + T + ++ A KQL
Sbjct: 211 CDHCWHNVAAKYLSLKSEVDEEKINKLHTCVDYGTCSCRHIFTPEEMTC-SISSQATKQL 269

Query: 363 TFGRCPEVMRCQVQRVVVS-SGELVKWTGHVSFPLVLNLQPF 485
P+++ + R V GE VK GH+SFPL+L+L PF
Sbjct: 270 AITHFPKILCIHLLRASVGLDGEFVKRGGHISFPLLLDLSPF 311


>tr|B8ATS8|B8ATS8_ORYSI Putative uncharacterized protein OS=Oryza
sativa subsp. indica GN=OsI_15919 PE=4 SV=1
Length = 463

Score = 108 bits (271), Expect = 1e-22
Identities = 60/162 (37%), Positives = 85/162 (52%), Gaps = 1/162 (0%)
Frame = +3

Query: 3 TIGSMLMCQECGYKFSTQFQSFHEVPLSPPQFSNGNIVNGCNLEACLEQFTAPECISNVR 182
TIGS+L C+ C S F++F+ +PLSP NG+I+NGC+L CLE FTA E + N R
Sbjct: 143 TIGSILSCRNCSSVLSLDFENFYCLPLSPVATINGDIINGCSLVDCLEHFTALEHLDNYR 202

Query: 183 CSCCSHSXXXXXXXXXXXXDKAVFQRIKDCTFDDDCSCEQLVTQIGGSWKNVHVNAIKQL 362
C C H+ D+ ++ C CSC + T + ++ A KQL
Sbjct: 203 CDHCWHNVAAKYLSLKSEVDEEKINKLHTCVDYGTCSCRHIFTPEEMTC-SISSQATKQL 261

Query: 363 TFGRCPEVMRCQVQRVVVS-SGELVKWTGHVSFPLVLNLQPF 485
P+++ + R V GE VK GH+SFPL+L+L PF
Sbjct: 262 AITHFPKILCIHLLRASVGLDGEFVKRGGHISFPLLLDLSPF 303


>tr|B4FF77|B4FF77_MAIZE Putative uncharacterized protein OS=Zea mays
PE=2 SV=1
Length = 504

Score = 106 bits (264), Expect = 9e-22
Identities = 57/162 (35%), Positives = 83/162 (51%), Gaps = 1/162 (0%)
Frame = +3

Query: 3 TIGSMLMCQECGYKFSTQFQSFHEVPLSPPQFSNGNIVNGCNLEACLEQFTAPECISNVR 182
T+GS+L C+ C S F++FH +PLSP +NG+I +GC+L CL+ FT E + N R
Sbjct: 220 TVGSILSCRNCSSVLSLDFENFHCLPLSPVLNANGDITSGCSLVDCLKYFTVVEHLDNYR 279

Query: 183 CSCCSHSXXXXXXXXXXXXDKAVFQRIKDCTFDDDCSCEQLVTQIGGSWKNVHVNAIKQL 362
C C H D+ +++ C CSC + + + A KQL
Sbjct: 280 CDRCWHIIAAKYLSLRSEVDEEKVSKLQSCVDYGTCSCRDMF-PLESLPCSSSSRATKQL 338

Query: 363 TFGRCPEVMRCQVQRVVVS-SGELVKWTGHVSFPLVLNLQPF 485
+CP+++ R V GE +K GH+SFPL+LNL PF
Sbjct: 339 IISQCPKILCIHFLRASVGLDGEPIKHQGHISFPLLLNLSPF 380


>tr|Q7XUT7|Q7XUT7_ORYSA OSJNBa0042L16.10 protein OS=Oryza sativa
GN=OSJNBa0042L16.10 PE=4 SV=3
Length = 1153

Score = 94.4 bits (233), Expect = 4e-18
Identities = 53/147 (36%), Positives = 76/147 (51%), Gaps = 1/147 (0%)
Frame = +3

Query: 48 STQFQSFHEVPLSPPQFSNGNIVNGCNLEACLEQFTAPECISNVRCSCCSHSXXXXXXXX 227
S F++F+ +PLSP NG+I+NGC+L CLE FTA E + N RC C H+
Sbjct: 848 SLDFENFYCLPLSPVATINGDIINGCSLVDCLEHFTALEHLDNYRCDHCWHNVAAKYLSL 907

Query: 228 XXXXDKAVFQRIKDCTFDDDCSCEQLVTQIGGSWKNVHVNAIKQLTFGRCPEVMRCQVQR 407
D+ ++ C CSC + T + ++ A KQL P+++ + R
Sbjct: 908 KSEVDEEKINKLHTCVDYGTCSCRHIFTPEEMTC-SISSQATKQLAITHFPKILCIHLLR 966

Query: 408 VVVS-SGELVKWTGHVSFPLVLNLQPF 485
V GE VK GH+SFPL+L+L PF
Sbjct: 967 ASVGLDGEFVKRGGHISFPLLLDLSPF 993


>tr|A3ATY1|A3ATY1_ORYSJ Putative uncharacterized protein OS=Oryza
sativa subsp. japonica GN=OsJ_014253 PE=4 SV=1
Length = 1143

Score = 94.4 bits (233), Expect = 4e-18
Identities = 53/147 (36%), Positives = 76/147 (51%), Gaps = 1/147 (0%)
Frame = +3

Query: 48 STQFQSFHEVPLSPPQFSNGNIVNGCNLEACLEQFTAPECISNVRCSCCSHSXXXXXXXX 227
S F++F+ +PLSP NG+I+NGC+L CLE FTA E + N RC C H+
Sbjct: 838 SLDFENFYCLPLSPVATINGDIINGCSLVDCLEHFTALEHLDNYRCDHCWHNVAAKYLSL 897

Query: 228 XXXXDKAVFQRIKDCTFDDDCSCEQLVTQIGGSWKNVHVNAIKQLTFGRCPEVMRCQVQR 407
D+ ++ C CSC + T + ++ A KQL P+++ + R
Sbjct: 898 KSEVDEEKINKLHTCVDYGTCSCRHIFTPEEMTC-SISSQATKQLAITHFPKILCIHLLR 956

Query: 408 VVVS-SGELVKWTGHVSFPLVLNLQPF 485
V GE VK GH+SFPL+L+L PF
Sbjct: 957 ASVGLDGEFVKRGGHISFPLLLDLSPF 983


>tr|B6ME74|B6ME74_BRAFL Putative uncharacterized protein
OS=Branchiostoma floridae GN=BRAFLDRAFT_81334 PE=4 SV=1
Length = 1453

Score = 47.8 bits (112), Expect = 4e-04
Identities = 41/161 (25%), Positives = 63/161 (39%), Gaps = 1/161 (0%)
Frame = +3

Query: 6 IGSMLMCQECGYKFSTQFQSFHEVPLSPPQFSNGNIVNGCNLEACLEQFTAPECISNVRC 185
+ S L C++C +K ++ F + LS P G LE L+QF E + NV C
Sbjct: 198 LASQLRCKQCWHKCPVKYDHFDSLSLSLPADELGPHT----LEGLLQQFVMSETVQNVEC 253

Query: 186 SCCSHSXXXXXXXXXXXXDKAVFQRIKDCTFDDDCSCEQLVTQIGGSWKNVHVNAIKQLT 365
C + C ++++ G S + IKQLT
Sbjct: 254 ENCQKA---------------------SCPWEEE----------GASARTAF---IKQLT 279

Query: 366 FGRCPEVMRCQVQRVV-VSSGELVKWTGHVSFPLVLNLQPF 485
G+ P+ M +QR V + +G K V FP L++ F
Sbjct: 280 LGKLPQCMCIHIQRTVWLDNGTPTKRKDQVLFPEYLDMAAF 320