BP918084
Clone id YMU001_000109_D08
Library
Length 503
Definition Adiantum capillus-veneris mRNA. clone: YMU001_000109_D08.
Accession
Tissue type prothallium
Developmental stage -
Contig ID
Sequence
GACAATGCTTCCTCATCAAAGCCATGTTCAAGATATCGTGAGCTCAATGCATTCCATGAA
ACAACATCCTGTACCTGCAACTCATCGAACACATCCCTTGCTTCTAGAAGCATAACACAC
CTGGCATACACATCCACTAAAGTATTCCCAACAAAAGTATCTCTTTCAAACCCCTCTATT
GCAATCATTGAGTGAAGTTCACGTCCTCTATCAAGCGCGCCTATCTGGCCACATGCTTTC
AAACCGCAGACAAATGTAACATCATTAGGAGCGACTCCATCTGCTTGCATCTCTTTCAGA
CAATTGAGTGCTTCAGCACCAAAACAATGATCAGCGTACCCTGATATTAATGCAGTCCAA
GAGACGACATTTCTTGAACATAGCTTGTCAAAAATCTTTAGTGCGTCAATAAGAGCACCA
GACCTGGCATATATGCCCACTAAGGCACTGCCAACAAGGGGATCCCTCTCTAGTCCCTCT
TTTGTAACCTCAATGTGTATGTC
■■Homology search results ■■ -
sp_hit_id Q0WNP3
Definition sp|Q0WNP3|PP319_ARATH Pentatricopeptide repeat-containing protein At4g18520 OS=Arabidopsis thaliana
Align length 167
Score (bit) 126.0
E-value 5.0e-29
Report
BLASTX 2.2.19 [Nov-02-2008]


Reference: Altschul, Stephen F., Thomas L. Madden, Alejandro A. Schaffer,
Jinghui Zhang, Zheng Zhang, Webb Miller, and David J. Lipman (1997),
"Gapped BLAST and PSI-BLAST: a new generation of protein database search
programs", Nucleic Acids Res. 25:3389-3402.

Query= BP918084|Adiantum capillus-veneris mRNA, clone:
YMU001_000109_D08.
(503 letters)

Database: uniprot_sprot.fasta
412,525 sequences; 148,809,765 total letters

Searching..................................................done



Score E
Sequences producing significant alignments: (bits) Value

sp|Q0WNP3|PP319_ARATH Pentatricopeptide repeat-containing protei... 126 5e-29
sp|Q9LIQ7|PP252_ARATH Pentatricopeptide repeat-containing protei... 124 2e-28
sp|Q9ZUW3|PP172_ARATH Pentatricopeptide repeat-containing protei... 122 7e-28
sp|Q9SZT8|PP354_ARATH Pentatricopeptide repeat-containing protei... 122 1e-27
sp|Q9SN39|PP320_ARATH Pentatricopeptide repeat-containing protei... 121 2e-27
sp|Q9SS83|PP220_ARATH Pentatricopeptide repeat-containing protei... 120 5e-27
sp|Q9SX45|PPR75_ARATH Pentatricopeptide repeat-containing protei... 119 1e-26
sp|Q9FM64|PP431_ARATH Pentatricopeptide repeat-containing protei... 117 2e-26
sp|Q9LW63|PP251_ARATH Putative pentatricopeptide repeat-containi... 117 2e-26
sp|P93005|PP181_ARATH Pentatricopeptide repeat-containing protei... 117 4e-26
sp|P93011|PP182_ARATH Pentatricopeptide repeat-containing protei... 116 5e-26
sp|P0C898|PP232_ARATH Putative pentatricopeptide repeat-containi... 115 1e-25
sp|Q9ZUT4|PP192_ARATH Pentatricopeptide repeat-containing protei... 115 1e-25
sp|Q9SUH6|PP341_ARATH Pentatricopeptide repeat-containing protei... 115 2e-25
sp|Q9SR82|PP219_ARATH Putative pentatricopeptide repeat-containi... 115 2e-25
sp|Q9LTV8|PP224_ARATH Pentatricopeptide repeat-containing protei... 114 2e-25
sp|O64705|PP184_ARATH Pentatricopeptide repeat-containing protei... 114 2e-25
sp|O04659|PP398_ARATH Pentatricopeptide repeat-containing protei... 114 3e-25
sp|Q9LYV3|PP377_ARATH Putative pentatricopeptide repeat-containi... 114 3e-25
sp|Q9SY02|PP301_ARATH Pentatricopeptide repeat-containing protei... 114 3e-25
sp|Q9LUJ2|PP249_ARATH Pentatricopeptide repeat-containing protei... 114 3e-25
sp|Q9M9E2|PPR45_ARATH Pentatricopeptide repeat-containing protei... 113 4e-25
sp|Q9LTF4|PP429_ARATH Putative pentatricopeptide repeat-containi... 113 4e-25
sp|Q9FJY7|PP449_ARATH Pentatricopeptide repeat-containing protei... 113 6e-25
sp|Q9FIF7|PP435_ARATH Putative pentatricopeptide repeat-containi... 112 7e-25
sp|Q9SIL5|PP165_ARATH Pentatricopeptide repeat-containing protei... 111 2e-24
sp|Q9CAA8|PP108_ARATH Putative pentatricopeptide repeat-containi... 111 2e-24
sp|A8MQA3|PP330_ARATH Pentatricopeptide repeat-containing protei... 111 2e-24
sp|Q9SI53|PP147_ARATH Pentatricopeptide repeat-containing protei... 111 2e-24
sp|Q9SB36|PP337_ARATH Pentatricopeptide repeat-containing protei... 110 3e-24

>sp|Q0WNP3|PP319_ARATH Pentatricopeptide repeat-containing protein
At4g18520 OS=Arabidopsis thaliana GN=PCMP-A2 PE=2 SV=1
Length = 617

Score = 126 bits (317), Expect = 5e-29
Identities = 66/167 (39%), Positives = 100/167 (59%)
Frame = -1

Query: 503 DIHIEVTKEGLERDPLVGSALVGIYARSGALIDALKIFDKLCSRNVVSWTALISGYADHC 324
++H ++ K +E++ +GS LV +Y + G DA + +L SR+VVSWTA+ISG +
Sbjct: 406 ELHAQIIKNSIEKNVYIGSTLVWLYCKCGESRDAFNVLQQLPSRDVVSWTAMISGCSSLG 465

Query: 323 FGAEALNCLKEMQADGVAPNDVTFVCGLKACGQIGALDRGRELHSMIAIEGFERDTFVGN 144
+EAL+ LKEM +GV PN T+ LKAC +L GR +HS+ + FVG+
Sbjct: 466 HESEALDFLKEMIQEGVEPNPFTYSSALKACANSESLLIGRSIHSIAKKNHALSNVFVGS 525

Query: 143 TLVDVYARCVMLLEARDVFDELQVQDVVSWNALSSRYLEHGFDEEAL 3
L+ +YA+C + EA VFD + +++VSW A+ Y +GF EAL
Sbjct: 526 ALIHMYAKCGFVSEAFRVFDSMPEKNLVSWKAMIMGYARNGFCREAL 572



Score = 124 bits (311), Expect = 2e-28
Identities = 62/166 (37%), Positives = 103/166 (62%)
Frame = -1

Query: 500 IHIEVTKEGLERDPLVGSALVGIYARSGALIDALKIFDKLCSRNVVSWTALISGYADHCF 321
+H V K ++ D VG++L+ +YA+ G + D K+FD + +RN V+WT++I+ +A F
Sbjct: 306 VHSLVVKRMIKTDVFVGTSLMDMYAKCGEISDCRKVFDGMSNRNTVTWTSIIAAHAREGF 365

Query: 320 GAEALNCLKEMQADGVAPNDVTFVCGLKACGQIGALDRGRELHSMIAIEGFERDTFVGNT 141
G EA++ + M+ + N++T V L+ACG +GAL G+ELH+ I E++ ++G+T
Sbjct: 366 GEEAISLFRIMKRRHLIANNLTVVSILRACGSVGALLLGKELHAQIIKNSIEKNVYIGST 425

Query: 140 LVDVYARCVMLLEARDVFDELQVQDVVSWNALSSRYLEHGFDEEAL 3
LV +Y +C +A +V +L +DVVSW A+ S G + EAL
Sbjct: 426 LVWLYCKCGESRDAFNVLQQLPSRDVVSWTAMISGCSSLGHESEAL 471



Score = 107 bits (267), Expect = 3e-23
Identities = 58/166 (34%), Positives = 96/166 (57%)
Frame = -1

Query: 500 IHIEVTKEGLERDPLVGSALVGIYARSGALIDALKIFDKLCSRNVVSWTALISGYADHCF 321
+H + K G+ + +V S+LV YA+ G L AL+ FD + ++V+SWTA+IS +
Sbjct: 206 VHGNMVKVGVG-NLIVESSLVYFYAQCGELTSALRAFDMMEEKDVISWTAVISACSRKGH 264

Query: 320 GAEALNCLKEMQADGVAPNDVTFVCGLKACGQIGALDRGRELHSMIAIEGFERDTFVGNT 141
G +A+ M PN+ T LKAC + AL GR++HS++ + D FVG +
Sbjct: 265 GIKAIGMFIGMLNHWFLPNEFTVCSILKACSEEKALRFGRQVHSLVVKRMIKTDVFVGTS 324

Query: 140 LVDVYARCVMLLEARDVFDELQVQDVVSWNALSSRYLEHGFDEEAL 3
L+D+YA+C + + R VFD + ++ V+W ++ + + GF EEA+
Sbjct: 325 LMDMYAKCGEISDCRKVFDGMSNRNTVTWTSIIAAHAREGFGEEAI 370



Score = 80.1 bits (196), Expect = 5e-15
Identities = 48/151 (31%), Positives = 77/151 (50%), Gaps = 1/151 (0%)
Frame = -1

Query: 452 GSALVGIYARSGALIDALKIFDKLCSRNVVSWTALISGYADHCFGAEALNCLKEMQADGV 273
G+ L+ R G L+ A K+FD + +N V+WTA+I GY + EA ++ G+
Sbjct: 120 GNNLISSCVRLGDLVYARKVFDSMPEKNTVTWTAMIDGYLKYGLEDEAFALFEDYVKHGI 179

Query: 272 A-PNDVTFVCGLKACGQIGALDRGRELHSMIAIEGFERDTFVGNTLVDVYARCVMLLEAR 96
N+ FVC L C + + GR++H + G + V ++LV YA+C L A
Sbjct: 180 RFTNERMFVCLLNLCSRRAEFELGRQVHGNMVKVGV-GNLIVESSLVYFYAQCGELTSAL 238

Query: 95 DVFDELQVQDVVSWNALSSRYLEHGFDEEAL 3
FD ++ +DV+SW A+ S G +A+
Sbjct: 239 RAFDMMEEKDVISWTAVISACSRKGHGIKAI 269



Score = 70.5 bits (171), Expect = 4e-12
Identities = 36/93 (38%), Positives = 53/93 (56%)
Frame = -1

Query: 500 IHIEVTKEGLERDPLVGSALVGIYARSGALIDALKIFDKLCSRNVVSWTALISGYADHCF 321
IH K + VGSAL+ +YA+ G + +A ++FD + +N+VSW A+I GYA + F
Sbjct: 508 IHSIAKKNHALSNVFVGSALIHMYAKCGFVSEAFRVFDSMPEKNLVSWKAMIMGYARNGF 567

Query: 320 GAEALNCLKEMQADGVAPNDVTFVCGLKACGQI 222
EAL + M+A+G +D F L CG I
Sbjct: 568 CREALKLMYRMEAEGFEVDDYIFATILSTCGDI 600



Score = 42.4 bits (98), Expect = 0.001
Identities = 22/67 (32%), Positives = 40/67 (59%), Gaps = 1/67 (1%)
Frame = -1

Query: 203 RELHSMIAIEGFERDT-FVGNTLVDVYARCVMLLEARDVFDELQVQDVVSWNALSSRYLE 27
+ +H+M A++ F+ + GN L+ R L+ AR VFD + ++ V+W A+ YL+
Sbjct: 102 KRIHAM-ALKCFDDQVIYFGNNLISSCVRLGDLVYARKVFDSMPEKNTVTWTAMIDGYLK 160

Query: 26 HGFDEEA 6
+G ++EA
Sbjct: 161 YGLEDEA 167


>sp|Q9LIQ7|PP252_ARATH Pentatricopeptide repeat-containing protein
At3g24000, mitochondrial OS=Arabidopsis thaliana
GN=PCMP-H87 PE=2 SV=1
Length = 633

Score = 124 bits (311), Expect = 2e-28
Identities = 66/166 (39%), Positives = 99/166 (59%)
Frame = -1

Query: 500 IHIEVTKEGLERDPLVGSALVGIYARSGALIDALKIFDKLCSRNVVSWTALISGYADHCF 321
+H K G + + VGSAL+ +Y R G + DA +FD L SRN VSW ALI+G+A
Sbjct: 183 LHGFCVKCGFDSNVHVGSALLDLYTRYGLMDDAQLVFDALESRNDVSWNALIAGHARRSG 242

Query: 320 GAEALNCLKEMQADGVAPNDVTFVCGLKACGQIGALDRGRELHSMIAIEGFERDTFVGNT 141
+AL + M DG P+ ++ AC G L++G+ +H+ + G + F GNT
Sbjct: 243 TEKALELFQGMLRDGFRPSHFSYASLFGACSSTGFLEQGKWVHAYMIKSGEKLVAFAGNT 302

Query: 140 LVDVYARCVMLLEARDVFDELQVQDVVSWNALSSRYLEHGFDEEAL 3
L+D+YA+ + +AR +FD L +DVVSWN+L + Y +HGF +EA+
Sbjct: 303 LLDMYAKSGSIHDARKIFDRLAKRDVVSWNSLLTAYAQHGFGKEAV 348



Score = 104 bits (259), Expect = 3e-22
Identities = 56/166 (33%), Positives = 94/166 (56%)
Frame = -1

Query: 500 IHIEVTKEGLERDPLVGSALVGIYARSGALIDALKIFDKLCSRNVVSWTALISGYADHCF 321
+H + + D ++G+ L+ +YA+ G+L +A K+F+K+ R+ V+WT LISGY+ H
Sbjct: 82 VHAHILQSIFRHDIVMGNTLLNMYAKCGSLEEARKVFEKMPQRDFVTWTTLISGYSQHDR 141

Query: 320 GAEALNCLKEMQADGVAPNDVTFVCGLKACGQIGALDRGRELHSMIAIEGFERDTFVGNT 141
+AL +M G +PN+ T +KA G +LH GF+ + VG+
Sbjct: 142 PCDALLFFNQMLRFGYSPNEFTLSSVIKAAAAERRGCCGHQLHGFCVKCGFDSNVHVGSA 201

Query: 140 LVDVYARCVMLLEARDVFDELQVQDVVSWNALSSRYLEHGFDEEAL 3
L+D+Y R ++ +A+ VFD L+ ++ VSWNAL + + E+AL
Sbjct: 202 LLDLYTRYGLMDDAQLVFDALESRNDVSWNALIAGHARRSGTEKAL 247



Score = 101 bits (252), Expect = 2e-21
Identities = 53/153 (34%), Positives = 88/153 (57%), Gaps = 1/153 (0%)
Frame = -1

Query: 500 IHIEVTKEGLERDPLVGSALVGIYARSGALIDALKIFDKLCSRNVVSWTALISGYADHCF 321
+H + K G + G+ L+ +YA+SG++ DA KIFD+L R+VVSW +L++ YA H F
Sbjct: 284 VHAYMIKSGEKLVAFAGNTLLDMYAKSGSIHDARKIFDRLAKRDVVSWNSLLTAYAQHGF 343

Query: 320 GAEALNCLKEMQADGVAPNDVTFVCGLKACGQIGALDRGRELHSMIAIEGFERDTFVGNT 141
G EA+ +EM+ G+ PN+++F+ L AC G LD G + ++ +G + + T
Sbjct: 344 GKEAVWWFEEMRRVGIRPNEISFLSVLTACSHSGLLDEGWHYYELMKKDGIVPEAWHYVT 403

Query: 140 LVDVYARCVMLLEARDVFDELQVQDVVS-WNAL 45
+VD+ R L A +E+ ++ + W AL
Sbjct: 404 VVDLLGRAGDLNRALRFIEEMPIEPTAAIWKAL 436



Score = 60.5 bits (145), Expect = 4e-09
Identities = 32/80 (40%), Positives = 47/80 (58%)
Frame = -1

Query: 242 LKACGQIGALDRGRELHSMIAIEGFERDTFVGNTLVDVYARCVMLLEARDVFDELQVQDV 63
LK C L +GR +H+ I F D +GNTL+++YA+C L EAR VF+++ +D
Sbjct: 67 LKKCTVFKLLIQGRIVHAHILQSIFRHDIVMGNTLLNMYAKCGSLEEARKVFEKMPQRDF 126

Query: 62 VSWNALSSRYLEHGFDEEAL 3
V+W L S Y +H +AL
Sbjct: 127 VTWTTLISGYSQHDRPCDAL 146


>sp|Q9ZUW3|PP172_ARATH Pentatricopeptide repeat-containing protein
At2g27610 OS=Arabidopsis thaliana GN=PCMP-H60 PE=2 SV=1
Length = 868

Score = 122 bits (307), Expect = 7e-28
Identities = 61/166 (36%), Positives = 95/166 (57%)
Frame = -1

Query: 500 IHIEVTKEGLERDPLVGSALVGIYARSGALIDALKIFDKLCSRNVVSWTALISGYADHCF 321
+H + K G D VG++LV Y + D K+FD++ RNVV+WT LISGYA +
Sbjct: 115 LHCQCIKFGFLDDVSVGTSLVDTYMKGSNFKDGRKVFDEMKERNVVTWTTLISGYARNSM 174

Query: 320 GAEALNCLKEMQADGVAPNDVTFVCGLKACGQIGALDRGRELHSMIAIEGFERDTFVGNT 141
E L MQ +G PN TF L + G RG ++H+++ G ++ V N+
Sbjct: 175 NDEVLTLFMRMQNEGTQPNSFTFAAALGVLAEEGVGGRGLQVHTVVVKNGLDKTIPVSNS 234

Query: 140 LVDVYARCVMLLEARDVFDELQVQDVVSWNALSSRYLEHGFDEEAL 3
L+++Y +C + +AR +FD+ +V+ VV+WN++ S Y +G D EAL
Sbjct: 235 LINLYLKCGNVRKARILFDKTEVKSVVTWNSMISGYAANGLDLEAL 280



Score = 100 bits (250), Expect = 3e-21
Identities = 57/167 (34%), Positives = 94/167 (56%), Gaps = 1/167 (0%)
Frame = -1

Query: 500 IHIEVTKEGLERDPLVGSALVGIYARSGALIDALKIFDKL-CSRNVVSWTALISGYADHC 324
+H V K G D + +AL+ Y++ A++DAL++F ++ C NVVSWTA+ISG+ +
Sbjct: 317 LHCSVVKYGFLFDQNIRTALMVAYSKCTAMLDALRLFKEIGCVGNVVSWTAMISGFLQND 376

Query: 323 FGAEALNCLKEMQADGVAPNDVTFVCGLKACGQIGALDRGRELHSMIAIEGFERDTFVGN 144
EA++ EM+ GV PN+ T+ L A I E+H+ + +ER + VG
Sbjct: 377 GKEEAVDLFSEMKRKGVRPNEFTYSVILTALPVISP----SEVHAQVVKTNYERSSTVGT 432

Query: 143 TLVDVYARCVMLLEARDVFDELQVQDVVSWNALSSRYLEHGFDEEAL 3
L+D Y + + EA VF + +D+V+W+A+ + Y + G E A+
Sbjct: 433 ALLDAYVKLGKVEEAAKVFSGIDDKDIVAWSAMLAGYAQTGETEAAI 479



Score = 98.2 bits (243), Expect = 2e-20
Identities = 50/168 (29%), Positives = 90/168 (53%), Gaps = 1/168 (0%)
Frame = -1

Query: 503 DIHIEVTKEGLERDPLVGSALVGIYARSGALIDALKIFDKLCSRNVVSWTALISGYADHC 324
++H +V K ER VG+AL+ Y + G + +A K+F + +++V+W+A+++GYA
Sbjct: 414 EVHAQVVKTNYERSSTVGTALLDAYVKLGKVEEAAKVFSGIDDKDIVAWSAMLAGYAQTG 473

Query: 323 FGAEALNCLKEMQADGVAPNDVTFVCGLKACGQIGA-LDRGRELHSMIAIEGFERDTFVG 147
A+ E+ G+ PN+ TF L C A + +G++ H + V
Sbjct: 474 ETEAAIKMFGELTKGGIKPNEFTFSSILNVCAATNASMGQGKQFHGFAIKSRLDSSLCVS 533

Query: 146 NTLVDVYARCVMLLEARDVFDELQVQDVVSWNALSSRYLEHGFDEEAL 3
+ L+ +YA+ + A +VF + +D+VSWN++ S Y +HG +AL
Sbjct: 534 SALLTMYAKKGNIESAEEVFKRQREKDLVSWNSMISGYAQHGQAMKAL 581



Score = 92.8 bits (229), Expect = 8e-19
Identities = 53/167 (31%), Positives = 92/167 (55%), Gaps = 1/167 (0%)
Frame = -1

Query: 500 IHIEVTKEGLERDPLVGSALVGIYARSGALIDALKIFDKLCSRNVVSWTALISGYADHCF 321
+H V K GL++ V ++L+ +Y + G + A +FDK ++VV+W ++ISGYA +
Sbjct: 216 VHTVVVKNGLDKTIPVSNSLINLYLKCGNVRKARILFDKTEVKSVVTWNSMISGYAANGL 275

Query: 320 GAEALNCLKEMQADGVAPNDVTFVCGLKACGQIGALDRGRELHSMIAIEGFERDTFVGNT 141
EAL M+ + V ++ +F +K C + L +LH + GF D +
Sbjct: 276 DLEALGMFYSMRLNYVRLSESSFASVIKLCANLKELRFTEQLHCSVVKYGFLFDQNIRTA 335

Query: 140 LVDVYARCVMLLEARDVFDELQ-VQDVVSWNALSSRYLEHGFDEEAL 3
L+ Y++C +L+A +F E+ V +VVSW A+ S +L++ EEA+
Sbjct: 336 LMVAYSKCTAMLDALRLFKEIGCVGNVVSWTAMISGFLQNDGKEEAV 382



Score = 69.3 bits (168), Expect = 9e-12
Identities = 42/136 (30%), Positives = 73/136 (53%), Gaps = 1/136 (0%)
Frame = -1

Query: 482 KEGLERDPLVGSALVGIYARSGALIDALKIFDKLCSRNVVSWTALISGYADHCFGAEALN 303
K L+ V SAL+ +YA+ G + A ++F + +++VSW ++ISGYA H +AL+
Sbjct: 523 KSRLDSSLCVSSALLTMYAKKGNIESAEEVFKRQREKDLVSWNSMISGYAQHGQAMKALD 582

Query: 302 CLKEMQADGVAPNDVTFVCGLKACGQIGALDRGRELHSMIAIEGFERDTFVGNT-LVDVY 126
KEM+ V + VTF+ AC G ++ G + ++ + T N+ +VD+Y
Sbjct: 583 VFKEMKKRKVKMDGVTFIGVFAACTHAGLVEEGEKYFDIMVRDCKIAPTKEHNSCMVDLY 642

Query: 125 ARCVMLLEARDVFDEL 78
+R L +A V + +
Sbjct: 643 SRAGQLEKAMKVIENM 658



Score = 62.8 bits (151), Expect = 9e-10
Identities = 47/154 (30%), Positives = 71/154 (46%), Gaps = 4/154 (2%)
Frame = -1

Query: 452 GSALVGIYA----RSGALIDALKIFDKLCSRNVVSWTALISGYADHCFGAEALNCLKEMQ 285
G A V IY S L +A +FDK R+ S+ +L+ G++ EA +
Sbjct: 26 GVAQVRIYCFGTVSSSRLYNAHNLFDKSPGRDRESYISLLFGFSRDGRTQEAKRLFLNIH 85

Query: 284 ADGVAPNDVTFVCGLKACGQIGALDRGRELHSMIAIEGFERDTFVGNTLVDVYARCVMLL 105
G+ + F LK + GR+LH GF D VG +LVD Y +
Sbjct: 86 RLGMEMDCSIFSSVLKVSATLCDELFGRQLHCQCIKFGFLDDVSVGTSLVDTYMKGSNFK 145

Query: 104 EARDVFDELQVQDVVSWNALSSRYLEHGFDEEAL 3
+ R VFDE++ ++VV+W L S Y + ++E L
Sbjct: 146 DGRKVFDEMKERNVVTWTTLISGYARNSMNDEVL 179


>sp|Q9SZT8|PP354_ARATH Pentatricopeptide repeat-containing protein
At4g37380, chloroplastic OS=Arabidopsis thaliana
GN=PCMP-H48 PE=2 SV=1
Length = 632

Score = 122 bits (305), Expect = 1e-27
Identities = 67/198 (33%), Positives = 104/198 (52%), Gaps = 32/198 (16%)
Frame = -1

Query: 500 IHIEVTKEGLERDPLVGSALVGIYARSGALIDALKIFDKL-------------------- 381
IH V K GL DP V + LV +YA+ G ++ A K+FD++
Sbjct: 148 IHTHVLKFGLGIDPYVATGLVDVYAKGGDVVSAQKVFDRMPERSLVSSTAMITCYAKQGN 207

Query: 380 -----------CSRNVVSWTALISGYADHCFGAEALNCLKEMQADGVA-PNDVTFVCGLK 237
C R++VSW +I GYA H F +AL +++ A+G P+++T V L
Sbjct: 208 VEAARALFDSMCERDIVSWNVMIDGYAQHGFPNDALMLFQKLLAEGKPKPDEITVVAALS 267

Query: 236 ACGQIGALDRGRELHSMIAIEGFERDTFVGNTLVDVYARCVMLLEARDVFDELQVQDVVS 57
AC QIGAL+ GR +H + + V L+D+Y++C L EA VF++ +D+V+
Sbjct: 268 ACSQIGALETGRWIHVFVKSSRIRLNVKVCTGLIDMYSKCGSLEEAVLVFNDTPRKDIVA 327

Query: 56 WNALSSRYLEHGFDEEAL 3
WNA+ + Y HG+ ++AL
Sbjct: 328 WNAMIAGYAMHGYSQDAL 345



Score = 75.1 bits (183), Expect = 2e-13
Identities = 47/163 (28%), Positives = 82/163 (50%), Gaps = 3/163 (1%)
Frame = -1

Query: 500 IHIEVTKEGLERDPLVGSALVGIYARSGALIDALKIFDKLCSRNVVSWTALISGYADHCF 321
IH+ V + + V + L+ +Y++ G+L +A+ +F+ +++V+W A+I+GYA H +
Sbjct: 281 IHVFVKSSRIRLNVKVCTGLIDMYSKCGSLEEAVLVFNDTPRKDIVAWNAMIAGYAMHGY 340

Query: 320 GAEALNCLKEMQA-DGVAPNDVTFVCGLKACGQIGALDRG-RELHSMIAIEGFERDTFVG 147
+AL EMQ G+ P D+TF+ L+AC G ++ G R SM G +
Sbjct: 341 SQDALRLFNEMQGITGLQPTDITFIGTLQACAHAGLVNEGIRIFESMGQEYGIKPKIEHY 400

Query: 146 NTLVDVYARCVMLLEARDVFDELQVQ-DVVSWNALSSRYLEHG 21
LV + R L A + + + D V W+++ HG
Sbjct: 401 GCLVSLLGRAGQLKRAYETIKNMNMDADSVLWSSVLGSCKLHG 443



Score = 59.7 bits (143), Expect = 7e-09
Identities = 48/200 (24%), Positives = 85/200 (42%), Gaps = 34/200 (17%)
Frame = -1

Query: 500 IHIEVTKEGL---ERDPLVGSALVGIYARSGALIDALKIFDKLCSRNVVSWTALISGYAD 330
IH + + L R P++ L YA G + +L +F + ++ +TA I+ +
Sbjct: 48 IHAAILRHNLLLHPRYPVLNLKLHRAYASHGKIRHSLALFHQTIDPDLFLFTAAINTASI 107

Query: 329 HCFGAEALNCLKEMQADGVAPNDVTFVCGLKACGQIGALDRGRELHSMIAIEGFERDTFV 150
+ +A ++ + + PN+ TF LK+C + G+ +H+ + G D +V
Sbjct: 108 NGLKDQAFLLYVQLLSSEINPNEFTFSSLLKSC----STKSGKLIHTHVLKFGLGIDPYV 163

Query: 149 GNTLVDVYARCVMLLEARDVFDELQ-------------------------------VQDV 63
LVDVYA+ ++ A+ VFD + +D+
Sbjct: 164 ATGLVDVYAKGGDVVSAQKVFDRMPERSLVSSTAMITCYAKQGNVEAARALFDSMCERDI 223

Query: 62 VSWNALSSRYLEHGFDEEAL 3
VSWN + Y +HGF +AL
Sbjct: 224 VSWNVMIDGYAQHGFPNDAL 243


>sp|Q9SN39|PP320_ARATH Pentatricopeptide repeat-containing protein
At4g18750, chloroplastic OS=Arabidopsis thaliana
GN=PCMP-H45 PE=2 SV=1
Length = 871

Score = 121 bits (304), Expect = 2e-27
Identities = 58/167 (34%), Positives = 101/167 (60%), Gaps = 1/167 (0%)
Frame = -1

Query: 500 IHIEVTKEGLERDPLVGSALVGIYARSGALIDALKIFDKLCSRNVVSWTALISGYADHCF 321
+H + + L D V +AL+ +YA+ G++ +A +F ++ ++++SW +I GY+ +C+
Sbjct: 419 VHEWIKENDLGFDIFVSNALMDMYAKCGSMQEAELVFSEMRVKDIISWNTIIGGYSKNCY 478

Query: 320 GAEALNCLKEM-QADGVAPNDVTFVCGLKACGQIGALDRGRELHSMIAIEGFERDTFVGN 144
EAL+ + + +P++ T C L AC + A D+GRE+H I G+ D V N
Sbjct: 479 ANEALSLFNLLLEEKRFSPDERTVACVLPACASLSAFDKGREIHGYIMRNGYFSDRHVAN 538

Query: 143 TLVDVYARCVMLLEARDVFDELQVQDVVSWNALSSRYLEHGFDEEAL 3
+LVD+YA+C LL A +FD++ +D+VSW + + Y HGF +EA+
Sbjct: 539 SLVDMYAKCGALLLAHMLFDDIASKDLVSWTVMIAGYGMHGFGKEAI 585



Score = 110 bits (275), Expect = 4e-24
Identities = 55/166 (33%), Positives = 93/166 (56%)
Frame = -1

Query: 500 IHIEVTKEGLERDPLVGSALVGIYARSGALIDALKIFDKLCSRNVVSWTALISGYADHCF 321
+H K R+ + L+ +Y++ G L A +F ++ R+VVS+T++I+GYA
Sbjct: 318 VHSIGVKACFSREDRFCNTLLDMYSKCGDLDSAKAVFREMSDRSVVSYTSMIAGYAREGL 377

Query: 320 GAEALNCLKEMQADGVAPNDVTFVCGLKACGQIGALDRGRELHSMIAIEGFERDTFVGNT 141
EA+ +EM+ +G++P+ T L C + LD G+ +H I D FV N
Sbjct: 378 AGEAVKLFEEMEEEGISPDVYTVTAVLNCCARYRLLDEGKRVHEWIKENDLGFDIFVSNA 437

Query: 140 LVDVYARCVMLLEARDVFDELQVQDVVSWNALSSRYLEHGFDEEAL 3
L+D+YA+C + EA VF E++V+D++SWN + Y ++ + EAL
Sbjct: 438 LMDMYAKCGSMQEAELVFSEMRVKDIISWNTIIGGYSKNCYANEAL 483



Score = 90.5 bits (223), Expect = 4e-18
Identities = 49/166 (29%), Positives = 86/166 (51%)
Frame = -1

Query: 500 IHIEVTKEGLERDPLVGSALVGIYARSGALIDALKIFDKLCSRNVVSWTALISGYADHCF 321
+H + K G VG++LV Y ++ + A K+FD++ R+V+SW ++I+GY +
Sbjct: 217 LHGFILKSGFGERNSVGNSLVAFYLKNQRVDSARKVFDEMTERDVISWNSIINGYVSNGL 276

Query: 320 GAEALNCLKEMQADGVAPNDVTFVCGLKACGQIGALDRGRELHSMIAIEGFERDTFVGNT 141
+ L+ +M G+ + T V C + GR +HS+ F R+ NT
Sbjct: 277 AEKGLSVFVQMLVSGIEIDLATIVSVFAGCADSRLISLGRAVHSIGVKACFSREDRFCNT 336

Query: 140 LVDVYARCVMLLEARDVFDELQVQDVVSWNALSSRYLEHGFDEEAL 3
L+D+Y++C L A+ VF E+ + VVS+ ++ + Y G EA+
Sbjct: 337 LLDMYSKCGDLDSAKAVFREMSDRSVVSYTSMIAGYAREGLAGEAV 382



Score = 87.4 bits (215), Expect = 3e-17
Identities = 49/158 (31%), Positives = 82/158 (51%)
Frame = -1

Query: 476 GLERDPLVGSALVGIYARSGALIDALKIFDKLCSRNVVSWTALISGYADHCFGAEALNCL 297
G D +GS L +Y G L +A ++FD++ + W L++ A + ++
Sbjct: 124 GFVIDSNLGSKLSLMYTNCGDLKEASRVFDEVKIEKALFWNILMNELAKSGDFSGSIGLF 183

Query: 296 KEMQADGVAPNDVTFVCGLKACGQIGALDRGRELHSMIAIEGFERDTFVGNTLVDVYARC 117
K+M + GV + TF C K+ + ++ G +LH I GF VGN+LV Y +
Sbjct: 184 KKMMSSGVEMDSYTFSCVSKSFSSLRSVHGGEQLHGFILKSGFGERNSVGNSLVAFYLKN 243

Query: 116 VMLLEARDVFDELQVQDVVSWNALSSRYLEHGFDEEAL 3
+ AR VFDE+ +DV+SWN++ + Y+ +G E+ L
Sbjct: 244 QRVDSARKVFDEMTERDVISWNSIINGYVSNGLAEKGL 281



Score = 84.3 bits (207), Expect = 3e-16
Identities = 50/155 (32%), Positives = 84/155 (54%), Gaps = 2/155 (1%)
Frame = -1

Query: 503 DIHIEVTKEGLERDPLVGSALVGIYARSGALIDALKIFDKLCSRNVVSWTALISGYADHC 324
+IH + + G D V ++LV +YA+ GAL+ A +FD + S+++VSWT +I+GY H
Sbjct: 520 EIHGYIMRNGYFSDRHVANSLVDMYAKCGALLLAHMLFDDIASKDLVSWTVMIAGYGMHG 579

Query: 323 FGAEALNCLKEMQADGVAPNDVTFVCGLKACGQIGALDRGRELHSMIAIE-GFERDTFVG 147
FG EA+ +M+ G+ ++++FV L AC G +D G +++ E E
Sbjct: 580 FGKEAIALFNQMRQAGIEADEISFVSLLYACSHSGLVDEGWRFFNIMRHECKIEPTVEHY 639

Query: 146 NTLVDVYARCVMLLEARDVFDELQV-QDVVSWNAL 45
+VD+ AR L++A + + + D W AL
Sbjct: 640 ACIVDMLARTGDLIKAYRFIENMPIPPDATIWGAL 674



Score = 48.9 bits (115), Expect = 1e-05
Identities = 30/103 (29%), Positives = 49/103 (47%), Gaps = 1/103 (0%)
Frame = -1

Query: 326 CFGAEALNCLKEMQADGVAPNDVTFVCG-LKACGQIGALDRGRELHSMIAIEGFERDTFV 150
C N +K + G D +C L+ C +L G+E+ + I GF D+ +
Sbjct: 72 CESGNLENAVKLLCVSGKWDIDPRTLCSVLQLCADSKSLKDGKEVDNFIRGNGFVIDSNL 131

Query: 149 GNTLVDVYARCVMLLEARDVFDELQVQDVVSWNALSSRYLEHG 21
G+ L +Y C L EA VFDE++++ + WN L + + G
Sbjct: 132 GSKLSLMYTNCGDLKEASRVFDEVKIEKALFWNILMNELAKSG 174


>sp|Q9SS83|PP220_ARATH Pentatricopeptide repeat-containing protein
At3g09040, mitochondrial OS=Arabidopsis thaliana
GN=PCMP-E88 PE=2 SV=1
Length = 1028

Score = 120 bits (300), Expect = 5e-27
Identities = 63/168 (37%), Positives = 105/168 (62%), Gaps = 3/168 (1%)
Frame = -1

Query: 497 HIEVTKEGLERD-PLVGSALVGIYARSGALIDALKIFDKLCS-RNVVSWTALISGYADHC 324
H ++TK G + +G +L+G+Y S + +A +F +L S +++V WT ++SG++ +
Sbjct: 652 HGQITKRGFSSEGEYLGISLLGMYMNSRGMTEACALFSELSSPKSIVLWTGMMSGHSQNG 711

Query: 323 FGAEALNCLKEMQADGVAPNDVTFVCGLKACGQIGALDRGRELHSMIAIEGFERDTFVGN 144
F EAL KEM+ DGV P+ TFV L+ C + +L GR +HS+I + D N
Sbjct: 712 FYEEALKFYKEMRHDGVLPDQATFVTVLRVCSVLSSLREGRAIHSLIFHLAHDLDELTSN 771

Query: 143 TLVDVYARCVMLLEARDVFDELQVQ-DVVSWNALSSRYLEHGFDEEAL 3
TL+D+YA+C + + VFDE++ + +VVSWN+L + Y ++G+ E+AL
Sbjct: 772 TLIDMYAKCGDMKGSSQVFDEMRRRSNVVSWNSLINGYAKNGYAEDAL 819



Score = 112 bits (280), Expect = 1e-24
Identities = 56/162 (34%), Positives = 94/162 (58%)
Frame = -1

Query: 497 HIEVTKEGLERDPLVGSALVGIYARSGALIDALKIFDKLCSRNVVSWTALISGYADHCFG 318
H + K+ L ++ VG+ALV +YA+ GAL DA +IF+++C R+ V+W +I Y
Sbjct: 451 HSIIIKKKLAKNLFVGNALVDMYAKCGALEDARQIFERMCDRDNVTWNTIIGSYVQDENE 510

Query: 317 AEALNCLKEMQADGVAPNDVTFVCGLKACGQIGALDRGRELHSMIAIEGFERDTFVGNTL 138
+EA + K M G+ + LKAC + L +G+++H + G +RD G++L
Sbjct: 511 SEAFDLFKRMNLCGIVSDGACLASTLKACTHVHGLYQGKQVHCLSVKCGLDRDLHTGSSL 570

Query: 137 VDVYARCVMLLEARDVFDELQVQDVVSWNALSSRYLEHGFDE 12
+D+Y++C ++ +AR VF L VVS NAL + Y ++ +E
Sbjct: 571 IDMYSKCGIIKDARKVFSSLPEWSVVSMNALIAGYSQNNLEE 612



Score = 108 bits (269), Expect = 2e-23
Identities = 56/165 (33%), Positives = 92/165 (55%)
Frame = -1

Query: 500 IHIEVTKEGLERDPLVGSALVGIYARSGALIDALKIFDKLCSRNVVSWTALISGYADHCF 321
+H E K GL + VGS+LV +Y++ + A K+F+ L +N V W A+I GYA +
Sbjct: 349 VHAEAIKLGLASNIYVGSSLVSMYSKCEKMEAAAKVFEALEEKNDVFWNAMIRGYAHNGE 408

Query: 320 GAEALNCLKEMQADGVAPNDVTFVCGLKACGQIGALDRGRELHSMIAIEGFERDTFVGNT 141
+ + +M++ G +D TF L C L+ G + HS+I + ++ FVGN
Sbjct: 409 SHKVMELFMDMKSSGYNIDDFTFTSLLSTCAASHDLEMGSQFHSIIIKKKLAKNLFVGNA 468

Query: 140 LVDVYARCVMLLEARDVFDELQVQDVVSWNALSSRYLEHGFDEEA 6
LVD+YA+C L +AR +F+ + +D V+WN + Y++ + EA
Sbjct: 469 LVDMYAKCGALEDARQIFERMCDRDNVTWNTIIGSYVQDENESEA 513



Score = 94.7 bits (234), Expect = 2e-19
Identities = 58/168 (34%), Positives = 95/168 (56%), Gaps = 2/168 (1%)
Frame = -1

Query: 500 IHIEVTKEGLERDPLVGSALVGIYARSGALIDALKIFDKLCSRNVVSWTALISGYADHCF 321
+H K GL+RD GS+L+ +Y++ G + DA K+F L +VVS ALI+GY+ +
Sbjct: 551 VHCLSVKCGLDRDLHTGSSLIDMYSKCGIIKDARKVFSSLPEWSVVSMNALIAGYSQNNL 610

Query: 320 GAEALNCLKEMQADGVAPNDVTFVCGLKACGQIGALDRGRELHSMIAIEGFERD-TFVGN 144
EA+ +EM GV P+++TF ++AC + +L G + H I GF + ++G
Sbjct: 611 -EEAVVLFQEMLTRGVNPSEITFATIVEACHKPESLTLGTQFHGQITKRGFSSEGEYLGI 669

Query: 143 TLVDVYARCVMLLEARDVFDEL-QVQDVVSWNALSSRYLEHGFDEEAL 3
+L+ +Y + EA +F EL + +V W + S + ++GF EEAL
Sbjct: 670 SLLGMYMNSRGMTEACALFSELSSPKSIVLWTGMMSGHSQNGFYEEAL 717



Score = 88.6 bits (218), Expect = 2e-17
Identities = 49/166 (29%), Positives = 90/166 (54%)
Frame = -1

Query: 500 IHIEVTKEGLERDPLVGSALVGIYARSGALIDALKIFDKLCSRNVVSWTALISGYADHCF 321
+H + G++ + +G+A+V +YA+ + A K FD L ++V +W +++S Y+
Sbjct: 82 VHSKSLILGIDSEGRLGNAIVDLYAKCAQVSYAEKQFDFL-EKDVTAWNSMLSMYSSIGK 140

Query: 320 GAEALNCLKEMQADGVAPNDVTFVCGLKACGQIGALDRGRELHSMIAIEGFERDTFVGNT 141
+ L + + + PN TF L C + ++ GR++H + G ER+++ G
Sbjct: 141 PGKVLRSFVSLFENQIFPNKFTFSIVLSTCARETNVEFGRQIHCSMIKMGLERNSYCGGA 200

Query: 140 LVDVYARCVMLLEARDVFDELQVQDVVSWNALSSRYLEHGFDEEAL 3
LVD+YA+C + +AR VF+ + + V W L S Y++ G EEA+
Sbjct: 201 LVDMYAKCDRISDARRVFEWIVDPNTVCWTCLFSGYVKAGLPEEAV 246



Score = 76.6 bits (187), Expect = 6e-14
Identities = 46/153 (30%), Positives = 74/153 (48%)
Frame = -1

Query: 479 EGLERDPLVGSALVGIYARSGALIDALKIFDKLCSRNVVSWTALISGYADHCFGAEALNC 300
EG D L ++ Y R G L DA +F ++ S +VV+W +ISG+ A+
Sbjct: 255 EGHRPDHLAFVTVINTYIRLGKLKDARLLFGEMSSPDVVAWNVMISGHGKRGCETVAIEY 314

Query: 299 LKEMQADGVAPNDVTFVCGLKACGQIGALDRGRELHSMIAIEGFERDTFVGNTLVDVYAR 120
M+ V T L A G + LD G +H+ G + +VG++LV +Y++
Sbjct: 315 FFNMRKSSVKSTRSTLGSVLSAIGIVANLDLGLVVHAEAIKLGLASNIYVGSSLVSMYSK 374

Query: 119 CVMLLEARDVFDELQVQDVVSWNALSSRYLEHG 21
C + A VF+ L+ ++ V WNA+ Y +G
Sbjct: 375 CEKMEAAAKVFEALEEKNDVFWNAMIRGYAHNG 407



Score = 75.9 bits (185), Expect = 1e-13
Identities = 50/165 (30%), Positives = 83/165 (50%), Gaps = 3/165 (1%)
Frame = -1

Query: 500 IHIEVTKEGLERDPLVGSALVGIYARSGALIDALKIFDKLCSR-NVVSWTALISGYADHC 324
IH + + D L + L+ +YA+ G + + ++FD++ R NVVSW +LI+GYA +
Sbjct: 754 IHSLIFHLAHDLDELTSNTLIDMYAKCGDMKGSSQVFDEMRRRSNVVSWNSLINGYAKNG 813

Query: 323 FGAEALNCLKEMQADGVAPNDVTFVCGLKACGQIGALDRGREL-HSMIAIEGFERDTFVG 147
+ +AL M+ + P+++TF+ L AC G + GR++ MI G E
Sbjct: 814 YAEDALKIFDSMRQSHIMPDEITFLGVLTACSHAGKVSDGRKIFEMMIGQYGIEARVDHV 873

Query: 146 NTLVDVYARCVMLLEARDVFDELQVQ-DVVSWNALSSRYLEHGFD 15
+VD+ R L EA D + ++ D W++L HG D
Sbjct: 874 ACMVDLLGRWGYLQEADDFIEAQNLKPDARLWSSLLGACRIHGDD 918



Score = 73.2 bits (178), Expect = 7e-13
Identities = 47/166 (28%), Positives = 74/166 (44%)
Frame = -1

Query: 500 IHIEVTKEGLERDPLVGSALVGIYARSGALIDALKIFDKLCSRNVVSWTALISGYADHCF 321
IH + K GLER+ G ALV +YA+ + DA ++F+ + N V WT L SGY
Sbjct: 182 IHCSMIKMGLERNSYCGGALVDMYAKCDRISDARRVFEWIVDPNTVCWTCLFSGYVKAGL 241

Query: 320 GAEALNCLKEMQADGVAPNDVTFVCGLKACGQIGALDRGRELHSMIAIEGFERDTFVGNT 141
EA+ + M+ +G P+ + FV T
Sbjct: 242 PEEAVLVFERMRDEGHRPDHLAFV-----------------------------------T 266

Query: 140 LVDVYARCVMLLEARDVFDELQVQDVVSWNALSSRYLEHGFDEEAL 3
+++ Y R L +AR +F E+ DVV+WN + S + + G + A+
Sbjct: 267 VINTYIRLGKLKDARLLFGEMSSPDVVAWNVMISGHGKRGCETVAI 312



Score = 48.5 bits (114), Expect = 2e-05
Identities = 25/66 (37%), Positives = 39/66 (59%)
Frame = -1

Query: 218 ALDRGRELHSMIAIEGFERDTFVGNTLVDVYARCVMLLEARDVFDELQVQDVVSWNALSS 39
AL G+ +HS I G + + +GN +VD+YA+C + A FD L+ +DV +WN++ S
Sbjct: 75 ALRIGKAVHSKSLILGIDSEGRLGNAIVDLYAKCAQVSYAEKQFDFLE-KDVTAWNSMLS 133

Query: 38 RYLEHG 21
Y G
Sbjct: 134 MYSSIG 139


>sp|Q9SX45|PPR75_ARATH Pentatricopeptide repeat-containing protein
At1g50270 OS=Arabidopsis thaliana GN=PCMP-E42 PE=2 SV=1
Length = 596

Score = 119 bits (297), Expect = 1e-26
Identities = 62/154 (40%), Positives = 91/154 (59%), Gaps = 1/154 (0%)
Frame = -1

Query: 464 DPLVGSALVGIYARSGALIDALKIFDKLCSRNVVSWTALISGYA-DHCFGAEALNCLKEM 288
D +GS+LV +Y + DA K+FD++ SRNVV+WTALI+GY CF + + +EM
Sbjct: 239 DVFIGSSLVDMYGKCSCYDDAQKVFDEMPSRNVVTWTALIAGYVQSRCFD-KGMLVFEEM 297

Query: 287 QADGVAPNDVTFVCGLKACGQIGALDRGRELHSMIAIEGFERDTFVGNTLVDVYARCVML 108
VAPN+ T L AC +GAL RGR +H + E +T G TL+D+Y +C L
Sbjct: 298 LKSDVAPNEKTLSSVLSACAHVGALHRGRRVHCYMIKNSIEINTTAGTTLIDLYVKCGCL 357

Query: 107 LEARDVFDELQVQDVVSWNALSSRYLEHGFDEEA 6
EA VF+ L ++V +W A+ + + HG+ +A
Sbjct: 358 EEAILVFERLHEKNVYTWTAMINGFAAHGYARDA 391



Score = 111 bits (278), Expect = 2e-24
Identities = 58/158 (36%), Positives = 97/158 (61%), Gaps = 1/158 (0%)
Frame = -1

Query: 497 HIEVTKEGLERDPLVGSALVGIYARSGALIDALKIFDKLCSRNVVSWTALISGYADHCFG 318
H + K GL+ DP V ++L+ Y+ SG A ++FD ++VV+WTA+I G+ +
Sbjct: 126 HAHIVKFGLDSDPFVRNSLISGYSSSGLFDFASRLFDGAEDKDVVTWTAMIDGFVRNGSA 185

Query: 317 AEALNCLKEMQADGVAPNDVTFVCGLKACGQIGALDRGRELHSMIAIEG-FERDTFVGNT 141
+EA+ EM+ GVA N++T V LKA G++ + GR +H + G + D F+G++
Sbjct: 186 SEAMVYFVEMKKTGVAANEMTVVSVLKAAGKVEDVRFGRSVHGLYLETGRVKCDVFIGSS 245

Query: 140 LVDVYARCVMLLEARDVFDELQVQDVVSWNALSSRYLE 27
LVD+Y +C +A+ VFDE+ ++VV+W AL + Y++
Sbjct: 246 LVDMYGKCSCYDDAQKVFDEMPSRNVVTWTALIAGYVQ 283



Score = 89.4 bits (220), Expect = 9e-18
Identities = 50/161 (31%), Positives = 87/161 (54%), Gaps = 2/161 (1%)
Frame = -1

Query: 500 IHIEVTKEGLERDPLVGSALVGIYARSGALIDALKIFDKLCSRNVVSWTALISGYADHCF 321
+H + K +E + G+ L+ +Y + G L +A+ +F++L +NV +WTA+I+G+A H +
Sbjct: 328 VHCYMIKNSIEINTTAGTTLIDLYVKCGCLEEAILVFERLHEKNVYTWTAMINGFAAHGY 387

Query: 320 GAEALNCLKEMQADGVAPNDVTFVCGLKACGQIGALDRGRELH-SMIAIEGFERDTFVGN 144
+A + M + V+PN+VTF+ L AC G ++ GR L SM E
Sbjct: 388 ARDAFDLFYTMLSSHVSPNEVTFMAVLSACAHGGLVEEGRRLFLSMKGRFNMEPKADHYA 447

Query: 143 TLVDVYARCVMLLEARDVFDELQVQDV-VSWNALSSRYLEH 24
+VD++ R +L EA+ + + + ++ V W AL L H
Sbjct: 448 CMVDLFGRKGLLEEAKALIERMPMEPTNVVWGALFGSCLLH 488



Score = 48.1 bits (113), Expect = 2e-05
Identities = 38/140 (27%), Positives = 67/140 (47%), Gaps = 6/140 (4%)
Frame = -1

Query: 404 ALKIFDKLCSRNVVSWTALISGYADHCFGAEALN------CLKEMQADGVAPNDVTFVCG 243
A ++ +L + ++ W +LI H G LN + M+ +GV P+ TF
Sbjct: 55 ARRLLCQLQTLSIQLWDSLIG----HFSGGITLNRRLSFLAYRHMRRNGVIPSRHTFPPL 110

Query: 242 LKACGQIGALDRGRELHSMIAIEGFERDTFVGNTLVDVYARCVMLLEARDVFDELQVQDV 63
LKA ++ + H+ I G + D FV N+L+ Y+ + A +FD + +DV
Sbjct: 111 LKAVFKLRD-SNPFQFHAHIVKFGLDSDPFVRNSLISGYSSSGLFDFASRLFDGAEDKDV 169

Query: 62 VSWNALSSRYLEHGFDEEAL 3
V+W A+ ++ +G EA+
Sbjct: 170 VTWTAMIDGFVRNGSASEAM 189


>sp|Q9FM64|PP431_ARATH Pentatricopeptide repeat-containing protein
At5g55740, chloroplastic OS=Arabidopsis thaliana
GN=CRR21 PE=2 SV=1
Length = 830

Score = 117 bits (294), Expect = 2e-26
Identities = 58/166 (34%), Positives = 94/166 (56%)
Frame = -1

Query: 500 IHIEVTKEGLERDPLVGSALVGIYARSGALIDALKIFDKLCSRNVVSWTALISGYADHCF 321
+H V K GLE V S+L +Y + G L DA K+FD++ RN V+W AL+ GY +
Sbjct: 195 VHGYVVKSGLEDCVFVASSLADMYGKCGVLDDASKVFDEIPDRNAVAWNALMVGYVQNGK 254

Query: 320 GAEALNCLKEMQADGVAPNDVTFVCGLKACGQIGALDRGRELHSMIAIEGFERDTFVGNT 141
EA+ +M+ GV P VT L A +G ++ G++ H++ + G E D +G +
Sbjct: 255 NEEAIRLFSDMRKQGVEPTRVTVSTCLSASANMGGVEEGKQSHAIAIVNGMELDNILGTS 314

Query: 140 LVDVYARCVMLLEARDVFDELQVQDVVSWNALSSRYLEHGFDEEAL 3
L++ Y + ++ A VFD + +DVV+WN + S Y++ G E+A+
Sbjct: 315 LLNFYCKVGLIEYAEMVFDRMFEKDVVTWNLIISGYVQQGLVEDAI 360



Score = 95.1 bits (235), Expect = 2e-19
Identities = 48/165 (29%), Positives = 88/165 (53%)
Frame = -1

Query: 497 HIEVTKEGLERDPLVGSALVGIYARSGALIDALKIFDKLCSRNVVSWTALISGYADHCFG 318
H G+E D ++G++L+ Y + G + A +FD++ ++VV+W +ISGY
Sbjct: 297 HAIAIVNGMELDNILGTSLLNFYCKVGLIEYAEMVFDRMFEKDVVTWNLIISGYVQQGLV 356

Query: 317 AEALNCLKEMQADGVAPNDVTFVCGLKACGQIGALDRGRELHSMIAIEGFERDTFVGNTL 138
+A+ + M+ + + + VT + A + L G+E+ FE D + +T+
Sbjct: 357 EDAIYMCQLMRLEKLKYDCVTLATLMSAAARTENLKLGKEVQCYCIRHSFESDIVLASTV 416

Query: 137 VDVYARCVMLLEARDVFDELQVQDVVSWNALSSRYLEHGFDEEAL 3
+D+YA+C +++A+ VFD +D++ WN L + Y E G EAL
Sbjct: 417 MDMYAKCGSIVDAKKVFDSTVEKDLILWNTLLAAYAESGLSGEAL 461



Score = 90.9 bits (224), Expect = 3e-18
Identities = 58/168 (34%), Positives = 87/168 (51%), Gaps = 2/168 (1%)
Frame = -1

Query: 500 IHIEVTKEG--LERDPLVGSALVGIYARSGALIDALKIFDKLCSRNVVSWTALISGYADH 327
IH + K G R+ + + LV YA+ AL A +F KL RNV SW A+I
Sbjct: 92 IHARILKNGDFYARNEYIETKLVIFYAKCDALEIAEVLFSKLRVRNVFSWAAIIGVKCRI 151

Query: 326 CFGAEALNCLKEMQADGVAPNDVTFVCGLKACGQIGALDRGRELHSMIAIEGFERDTFVG 147
AL EM + + P++ KACG + GR +H + G E FV
Sbjct: 152 GLCEGALMGFVEMLENEIFPDNFVVPNVCKACGALKWSRFGRGVHGYVVKSGLEDCVFVA 211

Query: 146 NTLVDVYARCVMLLEARDVFDELQVQDVVSWNALSSRYLEHGFDEEAL 3
++L D+Y +C +L +A VFDE+ ++ V+WNAL Y+++G +EEA+
Sbjct: 212 SSLADMYGKCGVLDDASKVFDEIPDRNAVAWNALMVGYVQNGKNEEAI 259



Score = 71.2 bits (173), Expect = 2e-12
Identities = 46/165 (27%), Positives = 85/165 (51%), Gaps = 6/165 (3%)
Frame = -1

Query: 479 EGLERDPLVGSALVGIYARSGALIDALKIFDKLCSR----NVVSWTALISGYADHCFGAE 312
EG+ + + + ++ R+G + +A +F ++ S N++SWT +++G + E
Sbjct: 470 EGVPPNVITWNLIILSLLRNGQVDEAKDMFLQMQSSGIIPNLISWTTMMNGMVQNGCSEE 529

Query: 311 ALNCLKEMQADGVAPNDVTFVCGLKACGQIGALDRGRELHSMIAIEGFERDTFVG--NTL 138
A+ L++MQ G+ PN + L AC + +L GR +H I I + + V +L
Sbjct: 530 AILFLRKMQESGLRPNAFSITVALSACAHLASLHIGRTIHGYI-IRNLQHSSLVSIETSL 588

Query: 137 VDVYARCVMLLEARDVFDELQVQDVVSWNALSSRYLEHGFDEEAL 3
VD+YA+C + +A VF ++ NA+ S Y +G +EA+
Sbjct: 589 VDMYAKCGDINKAEKVFGSKLYSELPLSNAMISAYALYGNLKEAI 633



Score = 65.1 bits (157), Expect = 2e-10
Identities = 38/164 (23%), Positives = 76/164 (46%), Gaps = 4/164 (2%)
Frame = -1

Query: 482 KEGLERDPLVGSALVGIYARSGALIDALKIFDKLCSRNVVSWTALISGYADHCFGAEALN 303
+ E D ++ S ++ +YA+ G+++DA K+FD ++++ W L++ YA+ EAL
Sbjct: 403 RHSFESDIVLASTVMDMYAKCGSIVDAKKVFDSTVEKDLILWNTLLAAYAESGLSGEALR 462

Query: 302 CLKEMQADGVAPNDVTFVCGLKACGQIGALDRGRELHSMIAIEGFERDTFVGNTLVDVYA 123
MQ +GV PN +T+ N ++
Sbjct: 463 LFYGMQLEGVPPNVITW-----------------------------------NLIILSLL 487

Query: 122 RCVMLLEARDVFDELQ----VQDVVSWNALSSRYLEHGFDEEAL 3
R + EA+D+F ++Q + +++SW + + +++G EEA+
Sbjct: 488 RNGQVDEAKDMFLQMQSSGIIPNLISWTTMMNGMVQNGCSEEAI 531



Score = 41.2 bits (95), Expect = 0.003
Identities = 24/91 (26%), Positives = 47/91 (51%)
Frame = -1

Query: 455 VGSALVGIYARSGALIDALKIFDKLCSRNVVSWTALISGYADHCFGAEALNCLKEMQADG 276
+ ++LV +YA+ G + A K+F + A+IS YA + EA+ + ++ G
Sbjct: 584 IETSLVDMYAKCGDINKAEKVFGSKLYSELPLSNAMISAYALYGNLKEAIALYRSLEGVG 643

Query: 275 VAPNDVTFVCGLKACGQIGALDRGRELHSMI 183
+ P+++T L AC G +++ E+ + I
Sbjct: 644 LKPDNITITNVLSACNHAGDINQAIEIFTDI 674


>sp|Q9LW63|PP251_ARATH Putative pentatricopeptide repeat-containing
protein At3g23330 OS=Arabidopsis thaliana GN=PCMP-H32
PE=3 SV=1
Length = 715

Score = 117 bits (294), Expect = 2e-26
Identities = 57/167 (34%), Positives = 96/167 (57%)
Frame = -1

Query: 503 DIHIEVTKEGLERDPLVGSALVGIYARSGALIDALKIFDKLCSRNVVSWTALISGYADHC 324
+IH V ++G++ D +GS+LV +YA+S + D+ ++F +L R+ +SW +L++GY +
Sbjct: 263 EIHGYVIRKGIDSDVYIGSSLVDMYAKSARIEDSERVFSRLYCRDGISWNSLVAGYVQNG 322

Query: 323 FGAEALNCLKEMQADGVAPNDVTFVCGLKACGQIGALDRGRELHSMIAIEGFERDTFVGN 144
EAL ++M V P V F + AC + L G++LH + GF + F+ +
Sbjct: 323 RYNEALRLFRQMVTAKVKPGAVAFSSVIPACAHLATLHLGKQLHGYVLRGGFGSNIFIAS 382

Query: 143 TLVDVYARCVMLLEARDVFDELQVQDVVSWNALSSRYLEHGFDEEAL 3
LVD+Y++C + AR +FD + V D VSW A+ + HG EA+
Sbjct: 383 ALVDMYSKCGNIKAARKIFDRMNVLDEVSWTAIIMGHALHGHGHEAV 429



Score = 85.1 bits (209), Expect = 2e-16
Identities = 54/161 (33%), Positives = 84/161 (52%), Gaps = 2/161 (1%)
Frame = -1

Query: 500 IHIEVTKEGLERDPLVGSALVGIYARSGALIDALKIFDKLCSRNVVSWTALISGYADHCF 321
+H V + G + + SALV +Y++ G + A KIFD++ + VSWTA+I G+A H
Sbjct: 365 LHGYVLRGGFGSNIFIASALVDMYSKCGNIKAARKIFDRMNVLDEVSWTAIIMGHALHGH 424

Query: 320 GAEALNCLKEMQADGVAPNDVTFVCGLKACGQIGALDRG-RELHSMIAIEGFERDTFVGN 144
G EA++ +EM+ GV PN V FV L AC +G +D +SM + G ++
Sbjct: 425 GHEAVSLFEEMKRQGVKPNQVAFVAVLTACSHVGLVDEAWGYFNSMTKVYGLNQELEHYA 484

Query: 143 TLVDVYARCVMLLEARDVFDELQVQDVVS-WNALSSRYLEH 24
+ D+ R L EA + ++ V+ S W+ L S H
Sbjct: 485 AVADLLGRAGKLEEAYNFISKMCVEPTGSVWSTLLSSCSVH 525



Score = 82.8 bits (203), Expect = 8e-16
Identities = 39/132 (29%), Positives = 77/132 (58%)
Frame = -1

Query: 398 KIFDKLCSRNVVSWTALISGYADHCFGAEALNCLKEMQADGVAPNDVTFVCGLKACGQIG 219
++F+ + ++VVS+ +I+GYA +AL ++EM + P+ T L +
Sbjct: 197 RVFEVMPRKDVVSYNTIIAGYAQSGMYEDALRMVREMGTTDLKPDSFTLSSVLPIFSEYV 256

Query: 218 ALDRGRELHSMIAIEGFERDTFVGNTLVDVYARCVMLLEARDVFDELQVQDVVSWNALSS 39
+ +G+E+H + +G + D ++G++LVD+YA+ + ++ VF L +D +SWN+L +
Sbjct: 257 DVIKGKEIHGYVIRKGIDSDVYIGSSLVDMYAKSARIEDSERVFSRLYCRDGISWNSLVA 316

Query: 38 RYLEHGFDEEAL 3
Y+++G EAL
Sbjct: 317 GYVQNGRYNEAL 328



Score = 69.3 bits (168), Expect = 9e-12
Identities = 50/185 (27%), Positives = 82/185 (44%), Gaps = 36/185 (19%)
Frame = -1

Query: 449 SALVGIYARSGALIDALKIFDKLCSRNVVSWTALISGYADHCFGAEALNCLKEMQADGVA 270
S ++ IY L +AL +F L S V++W ++I + D ++AL EM+A G
Sbjct: 43 SIVISIYTNLKLLHEALLLFKTLKSPPVLAWKSVIRCFTDQSLFSKALASFVEMRASGRC 102

Query: 269 PNDVTFVCGLKACGQIGALDRGRELHSMIAIEGFERDTFVGNTLVDVYAR---------- 120
P+ F LK+C + L G +H I G + D + GN L+++YA+
Sbjct: 103 PDHNVFPSVLKSCTMMMDLRFGESVHGFIVRLGMDCDLYTGNALMNMYAKLLGMGSKISV 162

Query: 119 -----------------------CVM---LLEARDVFDELQVQDVVSWNALSSRYLEHGF 18
C+M + R VF+ + +DVVS+N + + Y + G
Sbjct: 163 GNVFDEMPQRTSNSGDEDVKAETCIMPFGIDSVRRVFEVMPRKDVVSYNTIIAGYAQSGM 222

Query: 17 DEEAL 3
E+AL
Sbjct: 223 YEDAL 227


>sp|P93005|PP181_ARATH Pentatricopeptide repeat-containing protein
At2g33680 OS=Arabidopsis thaliana GN=PCMP-E19 PE=2 SV=1
Length = 727

Score = 117 bits (292), Expect = 4e-26
Identities = 63/166 (37%), Positives = 97/166 (58%)
Frame = -1

Query: 500 IHIEVTKEGLERDPLVGSALVGIYARSGALIDALKIFDKLCSRNVVSWTALISGYADHCF 321
IH K GL + +ALV +Y++ +L +A K+FD RN ++W+A+++GY+ +
Sbjct: 243 IHCITIKNGLLGFVALSNALVTMYSKCESLNEACKMFDSSGDRNSITWSAMVTGYSQNGE 302

Query: 320 GAEALNCLKEMQADGVAPNDVTFVCGLKACGQIGALDRGRELHSMIAIEGFERDTFVGNT 141
EA+ M + G+ P++ T V L AC I L+ G++LHS + GFER F
Sbjct: 303 SLEAVKLFSRMFSAGIKPSEYTIVGVLNACSDICYLEEGKQLHSFLLKLGFERHLFATTA 362

Query: 140 LVDVYARCVMLLEARDVFDELQVQDVVSWNALSSRYLEHGFDEEAL 3
LVD+YA+ L +AR FD LQ +DV W +L S Y+++ +EEAL
Sbjct: 363 LVDMYAKAGCLADARKGFDCLQERDVALWTSLISGYVQNSDNEEAL 408



Score = 116 bits (290), Expect = 7e-26
Identities = 64/166 (38%), Positives = 92/166 (55%)
Frame = -1

Query: 500 IHIEVTKEGLERDPLVGSALVGIYARSGALIDALKIFDKLCSRNVVSWTALISGYADHCF 321
+H + K G ER +ALV +YA++G L DA K FD L R+V WT+LISGY +
Sbjct: 344 LHSFLLKLGFERHLFATTALVDMYAKAGCLADARKGFDCLQERDVALWTSLISGYVQNSD 403

Query: 320 GAEALNCLKEMQADGVAPNDVTFVCGLKACGQIGALDRGRELHSMIAIEGFERDTFVGNT 141
EAL + M+ G+ PND T LKAC + L+ G+++H GF + +G+
Sbjct: 404 NEEALILYRRMKTAGIIPNDPTMASVLKACSSLATLELGKQVHGHTIKHGFGLEVPIGSA 463

Query: 140 LVDVYARCVMLLEARDVFDELQVQDVVSWNALSSRYLEHGFDEEAL 3
L +Y++C L + VF +DVVSWNA+ S +G +EAL
Sbjct: 464 LSTMYSKCGSLEDGNLVFRRTPNKDVVSWNAMISGLSHNGQGDEAL 509



Score = 84.7 bits (208), Expect = 2e-16
Identities = 52/162 (32%), Positives = 87/162 (53%), Gaps = 2/162 (1%)
Frame = -1

Query: 500 IHIEVTKEGLERDPLVGSALVGIYARSGALIDALKIFDKLCSRNVVSWTALISGYADHCF 321
+H K G + +GSAL +Y++ G+L D +F + +++VVSW A+ISG + +
Sbjct: 445 VHGHTIKHGFGLEVPIGSALSTMYSKCGSLEDGNLVFRRTPNKDVVSWNAMISGLSHNGQ 504

Query: 320 GAEALNCLKEMQADGVAPNDVTFVCGLKACGQIGALDRGRELHSMIAIE-GFERDTFVGN 144
G EAL +EM A+G+ P+DVTFV + AC G ++RG +M++ + G +
Sbjct: 505 GDEALELFEEMLAEGMEPDDVTFVNIISACSHKGFVERGWFYFNMMSDQIGLDPKVDHYA 564

Query: 143 TLVDVYARCVMLLEARDVFDELQV-QDVVSWNALSSRYLEHG 21
+VD+ +R L EA++ + + + W L S HG
Sbjct: 565 CMVDLLSRAGQLKEAKEFIESANIDHGLCLWRILLSACKNHG 606



Score = 76.6 bits (187), Expect = 6e-14
Identities = 48/168 (28%), Positives = 85/168 (50%), Gaps = 3/168 (1%)
Frame = -1

Query: 497 HIEVTKEGLERDPLVGSALVGIYARSGALIDALKIFDKLCSRNVVSWTALISGYADHCFG 318
H V K D V ++LVG+Y ++G + D LK+F + RN +W+ ++SGYA
Sbjct: 141 HALVVKMSSFGDIYVDTSLVGMYCKAGLVEDGLKVFAYMPERNTYTWSTMVSGYATRGRV 200

Query: 317 AEAL---NCLKEMQADGVAPNDVTFVCGLKACGQIGALDRGRELHSMIAIEGFERDTFVG 147
EA+ N + +G + +D F L + + GR++H + G +
Sbjct: 201 EEAIKVFNLFLREKEEG-SDSDYVFTAVLSSLAATIYVGLGRQIHCITIKNGLLGFVALS 259

Query: 146 NTLVDVYARCVMLLEARDVFDELQVQDVVSWNALSSRYLEHGFDEEAL 3
N LV +Y++C L EA +FD ++ ++W+A+ + Y ++G EA+
Sbjct: 260 NALVTMYSKCESLNEACKMFDSSGDRNSITWSAMVTGYSQNGESLEAV 307



Score = 75.1 bits (183), Expect = 2e-13
Identities = 44/169 (26%), Positives = 82/169 (48%), Gaps = 3/169 (1%)
Frame = -1

Query: 500 IHIEVTKEGLERDPLVGSALVGIYARSGALIDALKIFDKLCSRNVVSWTALISGYADH-- 327
+H ++ + G + LV YA+ G L A IF+ + ++VVSW +LI+GY+ +
Sbjct: 36 VHGQIIRTGASTCIQHANVLVNFYAKCGKLAKAHSIFNAIICKDVVSWNSLITGYSQNGG 95

Query: 326 -CFGAEALNCLKEMQADGVAPNDVTFVCGLKACGQIGALDRGRELHSMIAIEGFERDTFV 150
+ +EM+A + PN T KA + + GR+ H+++ D +V
Sbjct: 96 ISSSYTVMQLFREMRAQDILPNAYTLAGIFKAESSLQSSTVGRQAHALVVKMSSFGDIYV 155

Query: 149 GNTLVDVYARCVMLLEARDVFDELQVQDVVSWNALSSRYLEHGFDEEAL 3
+LV +Y + ++ + VF + ++ +W+ + S Y G EEA+
Sbjct: 156 DTSLVGMYCKAGLVEDGLKVFAYMPERNTYTWSTMVSGYATRGRVEEAI 204



Score = 47.8 bits (112), Expect = 3e-05
Identities = 28/83 (33%), Positives = 42/83 (50%)
Frame = -1

Query: 269 PNDVTFVCGLKACGQIGALDRGRELHSMIAIEGFERDTFVGNTLVDVYARCVMLLEARDV 90
P+ T + L Q L GR +H I G N LV+ YA+C L +A +
Sbjct: 12 PHTSTLLKKLTHHSQQRNLVAGRAVHGQIIRTGASTCIQHANVLVNFYAKCGKLAKAHSI 71

Query: 89 FDELQVQDVVSWNALSSRYLEHG 21
F+ + +DVVSWN+L + Y ++G
Sbjct: 72 FNAIICKDVVSWNSLITGYSQNG 94


tr_hit_id A9T8E9
Definition tr|A9T8E9|A9T8E9_PHYPA Predicted protein OS=Physcomitrella patens subsp. patens
Align length 167
Score (bit) 143.0
E-value 5.0e-33
Report
BLASTX 2.2.19 [Nov-02-2008]


Reference: Altschul, Stephen F., Thomas L. Madden, Alejandro A. Schaffer,
Jinghui Zhang, Zheng Zhang, Webb Miller, and David J. Lipman (1997),
"Gapped BLAST and PSI-BLAST: a new generation of protein database search
programs", Nucleic Acids Res. 25:3389-3402.

Query= BP918084|Adiantum capillus-veneris mRNA, clone:
YMU001_000109_D08.
(503 letters)

Database: uniprot_trembl.fasta
7,341,751 sequences; 2,391,615,440 total letters

Searching..................................................done



Score E
Sequences producing significant alignments: (bits) Value

tr|A9T8E9|A9T8E9_PHYPA Predicted protein OS=Physcomitrella paten... 143 5e-33
tr|B8LKN6|B8LKN6_PICSI Putative uncharacterized protein OS=Picea... 142 7e-33
tr|A7PEB0|A7PEB0_VITVI Chromosome chr11 scaffold_13, whole genom... 139 1e-31
tr|A9RJW2|A9RJW2_PHYPA Predicted protein OS=Physcomitrella paten... 138 1e-31
tr|A9U2Q7|A9U2Q7_PHYPA Predicted protein OS=Physcomitrella paten... 134 2e-30
tr|A9T480|A9T480_PHYPA Predicted protein (Fragment) OS=Physcomit... 134 2e-30
tr|A5B2K7|A5B2K7_VITVI Putative uncharacterized protein OS=Vitis... 133 4e-30
tr|Q5W965|Q5W965_PHYPA PPR868-14 OS=Physcomitrella patens PE=2 SV=1 133 5e-30
tr|B8LQA8|B8LQA8_PICSI Putative uncharacterized protein OS=Picea... 133 5e-30
tr|A9SDQ1|A9SDQ1_PHYPA Predicted protein OS=Physcomitrella paten... 133 5e-30
tr|A7QPS9|A7QPS9_VITVI Chromosome chr10 scaffold_138, whole geno... 132 9e-30
tr|Q5W963|Q5W963_PHYPA PPR1106-17 OS=Physcomitrella patens PE=2 ... 131 2e-29
tr|A9RSU9|A9RSU9_PHYPA Predicted protein OS=Physcomitrella paten... 131 2e-29
tr|B8LLJ0|B8LLJ0_PICSI Putative uncharacterized protein OS=Picea... 130 3e-29
tr|Q2QWV0|Q2QWV0_ORYSJ Os12g0181900 protein OS=Oryza sativa subs... 130 5e-29
tr|A7NSK1|A7NSK1_VITVI Chromosome chr18 scaffold_1, whole genome... 130 5e-29
tr|A9TDA2|A9TDA2_PHYPA Predicted protein OS=Physcomitrella paten... 129 6e-29
tr|A9T938|A9T938_PHYPA Predicted protein OS=Physcomitrella paten... 129 8e-29
tr|A7PW61|A7PW61_VITVI Chromosome chr8 scaffold_34, whole genome... 129 8e-29
tr|A7R6X2|A7R6X2_VITVI Chromosome undetermined scaffold_1472, wh... 128 2e-28
tr|A7R402|A7R402_VITVI Chromosome undetermined scaffold_596, who... 128 2e-28
tr|A7QIL2|A7QIL2_VITVI Chromosome chr9 scaffold_104, whole genom... 128 2e-28
tr|A7PWA0|A7PWA0_VITVI Chromosome chr8 scaffold_34, whole genome... 128 2e-28
tr|A2ZIP8|A2ZIP8_ORYSI Putative uncharacterized protein OS=Oryza... 128 2e-28
tr|A2YA32|A2YA32_ORYSI Putative uncharacterized protein OS=Oryza... 127 2e-28
tr|Q2HS18|Q2HS18_MEDTR Tetratricopeptide-like helical OS=Medicag... 126 5e-28
tr|A3B2H6|A3B2H6_ORYSJ Putative uncharacterized protein OS=Oryza... 126 5e-28
tr|A2Y335|A2Y335_ORYSI Putative uncharacterized protein OS=Oryza... 126 5e-28
tr|A7R0D7|A7R0D7_VITVI Chromosome chr6 scaffold_305, whole genom... 126 7e-28
tr|A7NVQ9|A7NVQ9_VITVI Chromosome chr18 scaffold_1, whole genome... 126 7e-28

>tr|A9T8E9|A9T8E9_PHYPA Predicted protein OS=Physcomitrella patens
subsp. patens GN=PHYPADRAFT_192620 PE=4 SV=1
Length = 902

Score = 143 bits (360), Expect = 5e-33
Identities = 72/167 (43%), Positives = 102/167 (61%)
Frame = -1

Query: 503 DIHIEVTKEGLERDPLVGSALVGIYARSGALIDALKIFDKLCSRNVVSWTALISGYADHC 324
+IH V K G D V +AL+ +Y+R G++ DA +FDK+ ++V+SWTA+I G A
Sbjct: 349 EIHSRVAKAGFTSDIGVQNALISMYSRCGSIKDARLVFDKMVRKDVISWTAMIGGLAKSG 408

Query: 323 FGAEALNCLKEMQADGVAPNDVTFVCGLKACGQIGALDRGRELHSMIAIEGFERDTFVGN 144
FGAEAL +EMQ GV PN VT+ L AC AL+ GR +H + G D VGN
Sbjct: 409 FGAEALTVYQEMQQAGVEPNRVTYTSILNACSSPAALEWGRRIHQQVVEAGLATDAHVGN 468

Query: 143 TLVDVYARCVMLLEARDVFDELQVQDVVSWNALSSRYLEHGFDEEAL 3
TLV++Y+ C + +AR VFD + +D+V++NA+ Y H +EAL
Sbjct: 469 TLVNMYSMCGSVKDARQVFDRMIQRDIVAYNAMIGGYAAHNLGKEAL 515



Score = 137 bits (344), Expect = 4e-31
Identities = 65/166 (39%), Positives = 105/166 (63%)
Frame = -1

Query: 500 IHIEVTKEGLERDPLVGSALVGIYARSGALIDALKIFDKLCSRNVVSWTALISGYADHCF 321
IH +V + GL D VG+ LV +Y+ G++ DA ++FD++ R++V++ A+I GYA H
Sbjct: 451 IHQQVVEAGLATDAHVGNTLVNMYSMCGSVKDARQVFDRMIQRDIVAYNAMIGGYAAHNL 510

Query: 320 GAEALNCLKEMQADGVAPNDVTFVCGLKACGQIGALDRGRELHSMIAIEGFERDTFVGNT 141
G EAL +Q +G+ P+ VT++ L AC G+L+ RE+H+++ GF DT VGN
Sbjct: 511 GKEALKLFDRLQEEGLKPDKVTYINMLNACANSGSLEWAREIHTLVRKGGFFSDTSVGNA 570

Query: 140 LVDVYARCVMLLEARDVFDELQVQDVVSWNALSSRYLEHGFDEEAL 3
LV YA+C +A VF+++ ++V+SWNA+ +HG ++AL
Sbjct: 571 LVSTYAKCGSFSDASIVFEKMTKRNVISWNAIIGGSAQHGRGQDAL 616



Score = 131 bits (330), Expect = 2e-29
Identities = 65/166 (39%), Positives = 100/166 (60%)
Frame = -1

Query: 500 IHIEVTKEGLERDPLVGSALVGIYARSGALIDALKIFDKLCSRNVVSWTALISGYADHCF 321
+H + G E D VG+ALV +YA+ G+ D ++F+KL +R++++W +I G A+ +
Sbjct: 249 VHSRILNAGHESDTAVGTALVKMYAKCGSYKDCRQVFEKLVNRDLIAWNTMIGGLAEGGY 308

Query: 320 GAEALNCLKEMQADGVAPNDVTFVCGLKACGQIGALDRGRELHSMIAIEGFERDTFVGNT 141
EA +MQ +GV PN +T+V L AC AL G+E+HS +A GF D V N
Sbjct: 309 WEEASEVYNQMQREGVMPNKITYVILLNACVNSAALHWGKEIHSRVAKAGFTSDIGVQNA 368

Query: 140 LVDVYARCVMLLEARDVFDELQVQDVVSWNALSSRYLEHGFDEEAL 3
L+ +Y+RC + +AR VFD++ +DV+SW A+ + GF EAL
Sbjct: 369 LISMYSRCGSIKDARLVFDKMVRKDVISWTAMIGGLAKSGFGAEAL 414



Score = 120 bits (302), Expect = 3e-26
Identities = 61/166 (36%), Positives = 97/166 (58%)
Frame = -1

Query: 503 DIHIEVTKEGLERDPLVGSALVGIYARSGALIDALKIFDKLCSRNVVSWTALISGYADHC 324
+IH + + GL D V + ++ +YA+ G++ +A ++FDK+ ++VVSWT I GYAD
Sbjct: 147 EIHFQAMQAGLLFDVKVANCILNMYAKCGSIEEAREVFDKMEKKSVVSWTITIGGYADCG 206

Query: 323 FGAEALNCLKEMQADGVAPNDVTFVCGLKACGQIGALDRGRELHSMIAIEGFERDTFVGN 144
A ++M+ +GV PN +T++ L A AL G+ +HS I G E DT VG
Sbjct: 207 RSETAFEIFQKMEQEGVVPNRITYISVLNAFSSPAALKWGKAVHSRILNAGHESDTAVGT 266

Query: 143 TLVDVYARCVMLLEARDVFDELQVQDVVSWNALSSRYLEHGFDEEA 6
LV +YA+C + R VF++L +D+++WN + E G+ EEA
Sbjct: 267 ALVKMYAKCGSYKDCRQVFEKLVNRDLIAWNTMIGGLAEGGYWEEA 312



Score = 103 bits (256), Expect = 6e-21
Identities = 55/167 (32%), Positives = 93/167 (55%), Gaps = 2/167 (1%)
Frame = -1

Query: 500 IHIEVTKEGLERDPLVGSALVGIYARSGALIDALKIFDKLC--SRNVVSWTALISGYADH 327
+H + + D +AL+ +Y + G++ +A +++ KL R V SW A++ GY +
Sbjct: 45 VHQHIIQHRTVPDQYTVNALINMYIQCGSIEEARQVWKKLSYMERTVHSWNAMVVGYIQY 104

Query: 326 CFGAEALNCLKEMQADGVAPNDVTFVCGLKACGQIGALDRGRELHSMIAIEGFERDTFVG 147
+ +AL L++MQ G+AP+ T + L +C GAL+ GRE+H G D V
Sbjct: 105 GYIEKALKLLRQMQQHGLAPDRTTIMSFLSSCKSPGALEWGREIHFQAMQAGLLFDVKVA 164

Query: 146 NTLVDVYARCVMLLEARDVFDELQVQDVVSWNALSSRYLEHGFDEEA 6
N ++++YA+C + EAR+VFD+++ + VVSW Y + G E A
Sbjct: 165 NCILNMYAKCGSIEEAREVFDKMEKKSVVSWTITIGGYADCGRSETA 211



Score = 92.4 bits (228), Expect = 1e-17
Identities = 59/163 (36%), Positives = 82/163 (50%), Gaps = 2/163 (1%)
Frame = -1

Query: 503 DIHIEVTKEGLERDPLVGSALVGIYARSGALIDALKIFDKLCSRNVVSWTALISGYADHC 324
+IH V K G D VG+ALV YA+ G+ DA +F+K+ RNV+SW A+I G A H
Sbjct: 551 EIHTLVRKGGFFSDTSVGNALVSTYAKCGSFSDASIVFEKMTKRNVISWNAIIGGSAQHG 610

Query: 323 FGAEALNCLKEMQADGVAPNDVTFVCGLKACGQIGALDRGRELHSMIAIEGFERDTFVG- 147
G +AL + M+ +GV P+ VTFV L AC G L+ GR ++ + T
Sbjct: 611 RGQDALQLFERMKMEGVKPDIVTFVSLLSACSHAGLLEEGRRYFCSMSQDFAIIPTIEHY 670

Query: 146 NTLVDVYARCVMLLEARDVFDELQVQ-DVVSWNALSSRYLEHG 21
+VD+ R L EA + + Q + W AL HG
Sbjct: 671 GCMVDLLGRAGQLDEAEALIKTMPFQANTRIWGALLGACRIHG 713



Score = 57.8 bits (138), Expect = 3e-07
Identities = 32/105 (30%), Positives = 58/105 (55%), Gaps = 2/105 (1%)
Frame = -1

Query: 311 ALNCLKEMQADGVAPNDVTFVCGLKACGQIGALDRGRELHSMIAIEGFERDTFVGNTLVD 132
A++ ++ +Q G N ++ LK C ++ L GR++H I D + N L++
Sbjct: 7 AVDVVQYLQQQGAQVNSSDYMKMLKRCIEVKDLVAGRQVHQHIIQHRTVPDQYTVNALIN 66

Query: 131 VYARCVMLLEARDVFDELQVQD--VVSWNALSSRYLEHGFDEEAL 3
+Y +C + EAR V+ +L + V SWNA+ Y+++G+ E+AL
Sbjct: 67 MYIQCGSIEEARQVWKKLSYMERTVHSWNAMVVGYIQYGYIEKAL 111


>tr|B8LKN6|B8LKN6_PICSI Putative uncharacterized protein OS=Picea
sitchensis PE=2 SV=1
Length = 394

Score = 142 bits (359), Expect = 7e-33
Identities = 70/164 (42%), Positives = 104/164 (63%), Gaps = 1/164 (0%)
Frame = -1

Query: 500 IHIEVTKEGLERDPLVGSALVGIYARSGALIDALKIFDKLCSRNVVSWTALISGYADHCF 321
I+ E+ +G E D +V +AL+ ++ + G++ DA ++FDK+C RN+VSWTA++SGYA F
Sbjct: 135 IYDEIISKGCEMDVIVENALINMFMKCGSIEDARRVFDKMCERNLVSWTAMVSGYAQGGF 194

Query: 320 GAEALNCLKEMQADGVAPNDVTFVCGLKACGQIGALDRGRELHSMIAIEGFERDTFVGNT 141
EAL EMQ + V N VT L AC Q+ L +G+E+H I G + VGN
Sbjct: 195 ADEALRMFYEMQGEDVKANYVTVASVLPACAQLSDLQQGKEIHGYIIRRGLDLGIVVGNA 254

Query: 140 LVDVYARCVMLLEARDVFDELQVQDVVSWNALSSRYLEHG-FDE 12
L+D+YA+C + A+ VFD++ +DVVSWN + Y ++G FDE
Sbjct: 255 LIDMYAKCGSIGSAQKVFDKMLQRDVVSWNVAIAGYAQNGRFDE 298



Score = 106 bits (264), Expect = 7e-22
Identities = 55/167 (32%), Positives = 92/167 (55%), Gaps = 1/167 (0%)
Frame = -1

Query: 500 IHIEVTKEGLERDPLVGSALVGIYARSGALIDALKIFDKLCSRNVVSWTALISGYADHCF 321
+H + G+ R P V + L+ +Y + G+L DA FD + +V W +I GY H
Sbjct: 33 VHAHMLLTGILRIPSVETKLLNLYVKCGSLPDARLAFDNMTKGDVFPWNVMIGGYVKHGE 92

Query: 320 GAEALNCLKEMQ-ADGVAPNDVTFVCGLKACGQIGALDRGRELHSMIAIEGFERDTFVGN 144
EAL +MQ P++ T+ L AC ++ +L G+ ++ I +G E D V N
Sbjct: 93 TREALELYHQMQKVSSTNPDNYTYSSVLNACARLASLSEGKLIYDEIISKGCEMDVIVEN 152

Query: 143 TLVDVYARCVMLLEARDVFDELQVQDVVSWNALSSRYLEHGFDEEAL 3
L++++ +C + +AR VFD++ +++VSW A+ S Y + GF +EAL
Sbjct: 153 ALINMFMKCGSIEDARRVFDKMCERNLVSWTAMVSGYAQGGFADEAL 199



Score = 87.8 bits (216), Expect = 3e-16
Identities = 49/160 (30%), Positives = 77/160 (48%), Gaps = 35/160 (21%)
Frame = -1

Query: 503 DIHIEVTKEGLERDPLVGSALVGIYARSGALIDALKIFDKLCSRNVVSWTALISGYA--- 333
+IH + + GL+ +VG+AL+ +YA+ G++ A K+FDK+ R+VVSW I+GYA
Sbjct: 235 EIHGYIIRRGLDLGIVVGNALIDMYAKCGSIGSAQKVFDKMLQRDVVSWNVAIAGYAQNG 294

Query: 332 --DHC------------------------------FGAEALNCLKEMQADGVAPNDVTFV 249
D C +G + L ++MQ GV PN +T
Sbjct: 295 RFDECMELFRKMQCAGLKIDVITWNTLITAYAQNGYGDQTLELFQQMQLRGVKPNSITIA 354

Query: 248 CGLKACGQIGALDRGRELHSMIAIEGFERDTFVGNTLVDV 129
L AC + AL G+ +H ++ + D VGN L+D+
Sbjct: 355 SVLSACAAVSALQEGKRIHDLVNRSECKSDICVGNALIDM 394



Score = 50.1 bits (118), Expect = 6e-05
Identities = 25/80 (31%), Positives = 41/80 (51%)
Frame = -1

Query: 242 LKACGQIGALDRGRELHSMIAIEGFERDTFVGNTLVDVYARCVMLLEARDVFDELQVQDV 63
L C + L +++H+ + + G R V L+++Y +C L +AR FD + DV
Sbjct: 18 LHLCTKAKTLAEAKQVHAHMLLTGILRIPSVETKLLNLYVKCGSLPDARLAFDNMTKGDV 77

Query: 62 VSWNALSSRYLEHGFDEEAL 3
WN + Y++HG EAL
Sbjct: 78 FPWNVMIGGYVKHGETREAL 97


>tr|A7PEB0|A7PEB0_VITVI Chromosome chr11 scaffold_13, whole genome
shotgun sequence OS=Vitis vinifera GN=GSVIVT00016595001
PE=4 SV=1
Length = 1005

Score = 139 bits (349), Expect = 1e-31
Identities = 68/166 (40%), Positives = 101/166 (60%)
Frame = -1

Query: 500 IHIEVTKEGLERDPLVGSALVGIYARSGALIDALKIFDKLCSRNVVSWTALISGYADHCF 321
+H ++ K L+ + VG+ALV +YA++ L DA IF++L R++ +WT +++GYA
Sbjct: 554 VHAQIVKNSLDGNDFVGTALVDMYAKNRFLEDAETIFNRLIKRDLFAWTVIVAGYAQDGQ 613

Query: 320 GAEALNCLKEMQADGVAPNDVTFVCGLKACGQIGALDRGRELHSMIAIEGFERDTFVGNT 141
G +A+ C +MQ +GV PN+ T L C +I LD GR+LHSM G D FV +
Sbjct: 614 GEKAVKCFIQMQREGVKPNEFTLASSLSGCSRIATLDSGRQLHSMAIKAGQSGDMFVASA 673

Query: 140 LVDVYARCVMLLEARDVFDELQVQDVVSWNALSSRYLEHGFDEEAL 3
LVD+YA+C + +A VFD L +D VSWN + Y +HG +AL
Sbjct: 674 LVDMYAKCGCVEDAEVVFDGLVSRDTVSWNTIICGYSQHGQGGKAL 719



Score = 120 bits (300), Expect = 5e-26
Identities = 64/166 (38%), Positives = 101/166 (60%)
Frame = -1

Query: 500 IHIEVTKEGLERDPLVGSALVGIYARSGALIDALKIFDKLCSRNVVSWTALISGYADHCF 321
IH +V K G+ D + ++LV +YA+ G+ A K+F ++ R+VVSWTALI+G+ +
Sbjct: 150 IHGQVIKSGINPDSHLWNSLVNVYAKCGSANYACKVFGEIPERDVVSWTALITGFVAEGY 209

Query: 320 GAEALNCLKEMQADGVAPNDVTFVCGLKACGQIGALDRGRELHSMIAIEGFERDTFVGNT 141
G+ A+N EM+ +GV N+ T+ LKAC L+ G+++H+ G D FVG+
Sbjct: 210 GSGAVNLFCEMRREGVEANEFTYATALKACSMCLDLEFGKQVHAEAIKVGDFSDLFVGSA 269

Query: 140 LVDVYARCVMLLEARDVFDELQVQDVVSWNALSSRYLEHGFDEEAL 3
LVD+YA+C ++ A VF + Q+ VSWNAL + + + G E+ L
Sbjct: 270 LVDLYAKCGEMVLAERVFLCMPKQNAVSWNALLNGFAQMGDAEKVL 315



Score = 110 bits (274), Expect = 5e-23
Identities = 55/166 (33%), Positives = 96/166 (57%)
Frame = -1

Query: 500 IHIEVTKEGLERDPLVGSALVGIYARSGALIDALKIFDKLCSRNVVSWTALISGYADHCF 321
IH V K G E D V +ALV +Y + G++ D ++F+ +R+++SW AL+SG+ D+
Sbjct: 453 IHACVCKYGFEYDNTVCNALVTMYMKIGSVQDGCRVFEATTNRDLISWNALLSGFHDNET 512

Query: 320 GAEALNCLKEMQADGVAPNDVTFVCGLKACGQIGALDRGRELHSMIAIEGFERDTFVGNT 141
L +M A+G PN TF+ L++C + +D G+++H+ I + + FVG
Sbjct: 513 CDTGLRIFNQMLAEGFNPNMYTFISILRSCSSLSDVDLGKQVHAQIVKNSLDGNDFVGTA 572

Query: 140 LVDVYARCVMLLEARDVFDELQVQDVVSWNALSSRYLEHGFDEEAL 3
LVD+YA+ L +A +F+ L +D+ +W + + Y + G E+A+
Sbjct: 573 LVDMYAKNRFLEDAETIFNRLIKRDLFAWTVIVAGYAQDGQGEKAV 618



Score = 96.7 bits (239), Expect = 6e-19
Identities = 57/165 (34%), Positives = 87/165 (52%)
Frame = -1

Query: 500 IHIEVTKEGLERDPLVGSALVGIYARSGALIDALKIFDKLCSRNVVSWTALISGYADHCF 321
+H E K G D VGSALV +YA+ G ++ A ++F + +N VSW AL++G+A
Sbjct: 251 VHAEAIKVGDFSDLFVGSALVDLYAKCGEMVLAERVFLCMPKQNAVSWNALLNGFAQMGD 310

Query: 320 GAEALNCLKEMQADGVAPNDVTFVCGLKACGQIGALDRGRELHSMIAIEGFERDTFVGNT 141
+ LN M + + T LK C G L G+ +HS+ G E D F+
Sbjct: 311 AEKVLNLFCRMTGSEINFSKFTLSTVLKGCANSGNLRAGQIVHSLAIRIGCELDEFISCC 370

Query: 140 LVDVYARCVMLLEARDVFDELQVQDVVSWNALSSRYLEHGFDEEA 6
LVD+Y++C + +A VF ++ DVVSW+A+ + + G EA
Sbjct: 371 LVDMYSKCGLAGDALKVFVRIEDPDVVSWSAIITCLDQKGQSREA 415



Score = 90.5 bits (223), Expect = 4e-17
Identities = 52/162 (32%), Positives = 82/162 (50%), Gaps = 2/162 (1%)
Frame = -1

Query: 500 IHIEVTKEGLERDPLVGSALVGIYARSGALIDALKIFDKLCSRNVVSWTALISGYADHCF 321
+H K G D V SALV +YA+ G + DA +FD L SR+ VSW +I GY+ H
Sbjct: 655 LHSMAIKAGQSGDMFVASALVDMYAKCGCVEDAEVVFDGLVSRDTVSWNTIICGYSQHGQ 714

Query: 320 GAEALNCLKEMQADGVAPNDVTFVCGLKACGQIGALDRGRE-LHSMIAIEGFERDTFVGN 144
G +AL + M +G P++VTF+ L AC +G ++ G++ +S+ I G
Sbjct: 715 GGKALKAFEAMLDEGTVPDEVTFIGVLSACSHMGLIEEGKKHFNSLSKIYGITPTIEHYA 774

Query: 143 TLVDVYARCVMLLEARDVFDELQV-QDVVSWNALSSRYLEHG 21
+VD+ R E +E+++ +V+ W + HG
Sbjct: 775 CMVDILGRAGKFHEVESFIEEMKLTSNVLIWETVLGACKMHG 816



Score = 90.1 bits (222), Expect = 5e-17
Identities = 51/156 (32%), Positives = 79/156 (50%)
Frame = -1

Query: 500 IHIEVTKEGLERDPLVGSALVGIYARSGALIDALKIFDKLCSRNVVSWTALISGYADHCF 321
+H + G E D + LV +Y++ G DALK+F ++ +VVSW+A+I+
Sbjct: 352 VHSLAIRIGCELDEFISCCLVDMYSKCGLAGDALKVFVRIEDPDVVSWSAIITCLDQKGQ 411

Query: 320 GAEALNCLKEMQADGVAPNDVTFVCGLKACGQIGALDRGRELHSMIAIEGFERDTFVGNT 141
EA K M+ GV PN T + A +G L G +H+ + GFE D V N
Sbjct: 412 SREAAEVFKRMRHSGVIPNQFTLASLVSAATDLGDLYYGESIHACVCKYGFEYDNTVCNA 471

Query: 140 LVDVYARCVMLLEARDVFDELQVQDVVSWNALSSRY 33
LV +Y + + + VF+ +D++SWNAL S +
Sbjct: 472 LVTMYMKIGSVQDGCRVFEATTNRDLISWNALLSGF 507



Score = 58.5 bits (140), Expect = 2e-07
Identities = 28/80 (35%), Positives = 45/80 (56%)
Frame = -1

Query: 242 LKACGQIGALDRGRELHSMIAIEGFERDTFVGNTLVDVYARCVMLLEARDVFDELQVQDV 63
L+ C G L+ G+ +H + G D+ + N+LV+VYA+C A VF E+ +DV
Sbjct: 135 LRTCASKGDLNEGKAIHGQVIKSGINPDSHLWNSLVNVYAKCGSANYACKVFGEIPERDV 194

Query: 62 VSWNALSSRYLEHGFDEEAL 3
VSW AL + ++ G+ A+
Sbjct: 195 VSWTALITGFVAEGYGSGAV 214


>tr|A9RJW2|A9RJW2_PHYPA Predicted protein OS=Physcomitrella patens
subsp. patens GN=PHYPADRAFT_175641 PE=4 SV=1
Length = 723

Score = 138 bits (348), Expect = 1e-31
Identities = 70/166 (42%), Positives = 107/166 (64%)
Frame = -1

Query: 500 IHIEVTKEGLERDPLVGSALVGIYARSGALIDALKIFDKLCSRNVVSWTALISGYADHCF 321
+H+E+ + GLE +P VG++LVG+YA+ G + A IFD+L +NVV+WT LI+GYA
Sbjct: 170 VHMEIVEAGLELEPRVGTSLVGMYAKCGDISKARVIFDRLPEKNVVTWTLLIAGYAQQGQ 229

Query: 320 GAEALNCLKEMQADGVAPNDVTFVCGLKACGQIGALDRGRELHSMIAIEGFERDTFVGNT 141
AL L+ MQ VAPN +TF L+ C AL+ G+++H I G+ R+ +V N+
Sbjct: 230 VDVALELLETMQQAEVAPNKITFASILQGCTTPAALEHGKKVHRYIIQSGYGRELWVVNS 289

Query: 140 LVDVYARCVMLLEARDVFDELQVQDVVSWNALSSRYLEHGFDEEAL 3
L+ +Y +C L EAR +F +L +DVV+W A+ + Y + GF +EA+
Sbjct: 290 LITMYCKCGGLEEARKLFSDLPHRDVVTWTAMVTGYAQLGFHDEAI 335



Score = 111 bits (278), Expect = 2e-23
Identities = 58/167 (34%), Positives = 95/167 (56%)
Frame = -1

Query: 503 DIHIEVTKEGLERDPLVGSALVGIYARSGALIDALKIFDKLCSRNVVSWTALISGYADHC 324
++H + K G++ + + + L+ +YA+ G+L DA ++FD + RN+VSWTA+I +
Sbjct: 68 EVHAAILKSGIQPNRYLENTLLSMYAKCGSLTDARRVFDSIRDRNIVSWTAMIEAFVAGN 127

Query: 323 FGAEALNCLKEMQADGVAPNDVTFVCGLKACGQIGALDRGRELHSMIAIEGFERDTFVGN 144
EA C + M+ G P+ VTFV L A L G+++H I G E + VG
Sbjct: 128 KNLEAFKCYETMKLAGCKPDKVTFVSLLNAFTNPELLQLGQKVHMEIVEAGLELEPRVGT 187

Query: 143 TLVDVYARCVMLLEARDVFDELQVQDVVSWNALSSRYLEHGFDEEAL 3
+LV +YA+C + +AR +FD L ++VV+W L + Y + G + AL
Sbjct: 188 SLVGMYAKCGDISKARVIFDRLPEKNVVTWTLLIAGYAQQGQVDVAL 234



Score = 110 bits (275), Expect = 4e-23
Identities = 55/167 (32%), Positives = 97/167 (58%), Gaps = 1/167 (0%)
Frame = -1

Query: 500 IHIEVTKEGLERDPLVGSALVGIYARSGALIDALKIFDKLCSRNVVSWTALISGYADHCF 321
+H + + G R+ V ++L+ +Y + G L +A K+F L R+VV+WTA+++GYA F
Sbjct: 271 VHRYIIQSGYGRELWVVNSLITMYCKCGGLEEARKLFSDLPHRDVVTWTAMVTGYAQLGF 330

Query: 320 GAEALNCLKEMQADGVAPNDVTFVCGLKACGQIGALDRGRELHSMIAIEGFERDTFVGNT 141
EA+N + MQ G+ P+ +TF L +C L G+ +H + G+ D ++ +
Sbjct: 331 HDEAINLFRRMQQQGIKPDKMTFTSVLTSCSSPAFLQEGKRIHQQLVHAGYNLDVYLQSA 390

Query: 140 LVDVYARCVMLLEARDVFDELQVQDVVSWNA-LSSRYLEHGFDEEAL 3
LV +YA+C + +A VF+++ ++VV+W A ++ +HG EAL
Sbjct: 391 LVSMYAKCGSMDDASLVFNQMSERNVVAWTAIITGCCAQHGRCREAL 437



Score = 81.6 bits (200), Expect = 2e-14
Identities = 55/162 (33%), Positives = 83/162 (51%), Gaps = 3/162 (1%)
Frame = -1

Query: 500 IHIEVTKEGLERDPLVGSALVGIYARSGALIDALKIFDKLCSRNVVSWTALISGY-ADHC 324
IH ++ G D + SALV +YA+ G++ DA +F+++ RNVV+WTA+I+G A H
Sbjct: 372 IHQQLVHAGYNLDVYLQSALVSMYAKCGSMDDASLVFNQMSERNVVAWTAIITGCCAQHG 431

Query: 323 FGAEALNCLKEMQADGVAPNDVTFVCGLKACGQIGALDRGRE-LHSMIAIEGFERDTFVG 147
EAL +M+ G+ P+ VTF L AC +G ++ GR+ SM G +
Sbjct: 432 RCREALEYFDQMKKQGIKPDKVTFTSVLSACTHVGLVEEGRKHFRSMYLDYGIKPMVEHY 491

Query: 146 NTLVDVYARCVMLLEARDVFDELQ-VQDVVSWNALSSRYLEH 24
+ VD+ R L EA +V + + W AL S H
Sbjct: 492 SCFVDLLGRAGHLEEAENVILSMPFIPGPSVWGALLSACRVH 533



Score = 65.5 bits (158), Expect = 1e-09
Identities = 33/103 (32%), Positives = 59/103 (57%)
Frame = -1

Query: 314 EALNCLKEMQADGVAPNDVTFVCGLKACGQIGALDRGRELHSMIAIEGFERDTFVGNTLV 135
EAL + M G F L+ C ++ +L++GRE+H+ I G + + ++ NTL+
Sbjct: 30 EALGIMNTMILQGTRVYSDVFRGLLQECARLRSLEQGREVHAAILKSGIQPNRYLENTLL 89

Query: 134 DVYARCVMLLEARDVFDELQVQDVVSWNALSSRYLEHGFDEEA 6
+YA+C L +AR VFD ++ +++VSW A+ ++ + EA
Sbjct: 90 SMYAKCGSLTDARRVFDSIRDRNIVSWTAMIEAFVAGNKNLEA 132


>tr|A9U2Q7|A9U2Q7_PHYPA Predicted protein OS=Physcomitrella patens
subsp. patens GN=PHYPADRAFT_154890 PE=4 SV=1
Length = 922

Score = 134 bits (338), Expect = 2e-30
Identities = 73/165 (44%), Positives = 100/165 (60%)
Frame = -1

Query: 500 IHIEVTKEGLERDPLVGSALVGIYARSGALIDALKIFDKLCSRNVVSWTALISGYADHCF 321
IH +TK G E D V +AL+ +Y + G+L A K+F+++ RNVVSWTA+ISGY H
Sbjct: 174 IHSHITKAGYESDVNVSTALINMYCKCGSLELARKVFNEMRERNVVSWTAMISGYVQHGD 233

Query: 320 GAEALNCLKEMQADGVAPNDVTFVCGLKACGQIGALDRGRELHSMIAIEGFERDTFVGNT 141
EA +++ G PN V+F L AC L++G +LH+ I G E++ VGN
Sbjct: 234 SKEAFVLFQKLIRSGTQPNKVSFASILGACTNPNDLEQGLKLHAYIKQAGLEQEVLVGNA 293

Query: 140 LVDVYARCVMLLEARDVFDELQVQDVVSWNALSSRYLEHGFDEEA 6
L+ +YARC L AR VFD L+ + VSWNA+ + Y E GF EEA
Sbjct: 294 LISMYARCGSLANARQVFDNLRSPNRVSWNAMIAGYGE-GFMEEA 337



Score = 129 bits (325), Expect = 6e-29
Identities = 67/165 (40%), Positives = 100/165 (60%)
Frame = -1

Query: 500 IHIEVTKEGLERDPLVGSALVGIYARSGALIDALKIFDKLCSRNVVSWTALISGYADHCF 321
+H + + GLE++ LVG+AL+ +YAR G+L +A ++FD L S N VSW A+I+GY + F
Sbjct: 275 LHAYIKQAGLEQEVLVGNALISMYARCGSLANARQVFDNLRSPNRVSWNAMIAGYGEG-F 333

Query: 320 GAEALNCLKEMQADGVAPNDVTFVCGLKACGQIGALDRGRELHSMIAIEGFERDTFVGNT 141
EA ++MQ G P+ T+ L C L+RG+ELHS I +E D V
Sbjct: 334 MEEAFRLFRDMQQKGFQPDRFTYASLLAICADRADLNRGKELHSQIVRTAWEADVTVATA 393

Query: 140 LVDVYARCVMLLEARDVFDELQVQDVVSWNALSSRYLEHGFDEEA 6
L+ +YA+C L EAR VF+++ ++ VSWNA + HG ++EA
Sbjct: 394 LISMYAKCGSLEEARKVFNQMPEKNAVSWNAFIACCCRHGSEKEA 438



Score = 123 bits (308), Expect = 6e-27
Identities = 61/165 (36%), Positives = 100/165 (60%)
Frame = -1

Query: 500 IHIEVTKEGLERDPLVGSALVGIYARSGALIDALKIFDKLCSRNVVSWTALISGYADHCF 321
+H + E D + + L+ +Y++ G++ DA +F + ++VVSW A+ISGYA H
Sbjct: 73 VHDHMRSAQFEPDIYLNNMLISMYSKCGSIEDANNVFQSMEDKDVVSWNAMISGYALHGR 132

Query: 320 GAEALNCLKEMQADGVAPNDVTFVCGLKACGQIGALDRGRELHSMIAIEGFERDTFVGNT 141
G EA++ +MQ +G+ PN +F+ L AC L+ G ++HS I G+E D V
Sbjct: 133 GQEAVDLFYQMQREGLKPNQNSFISILSACQTPIVLEFGEQIHSHITKAGYESDVNVSTA 192

Query: 140 LVDVYARCVMLLEARDVFDELQVQDVVSWNALSSRYLEHGFDEEA 6
L+++Y +C L AR VF+E++ ++VVSW A+ S Y++HG +EA
Sbjct: 193 LINMYCKCGSLELARKVFNEMRERNVVSWTAMISGYVQHGDSKEA 237



Score = 118 bits (296), Expect = 1e-25
Identities = 58/166 (34%), Positives = 96/166 (57%)
Frame = -1

Query: 503 DIHIEVTKEGLERDPLVGSALVGIYARSGALIDALKIFDKLCSRNVVSWTALISGYADHC 324
++H ++ + E D V +AL+ +YA+ G+L +A K+F+++ +N VSW A I+ H
Sbjct: 374 ELHSQIVRTAWEADVTVATALISMYAKCGSLEEARKVFNQMPEKNAVSWNAFIACCCRHG 433

Query: 323 FGAEALNCLKEMQADGVAPNDVTFVCGLKACGQIGALDRGRELHSMIAIEGFERDTFVGN 144
EA K+M+ D V P+ VTF+ L +C +RGR +H I G + V N
Sbjct: 434 SEKEAFQVFKQMRRDDVIPDHVTFITLLNSCTSPEDFERGRYIHGKIDQWGMLSNNLVAN 493

Query: 143 TLVDVYARCVMLLEARDVFDELQVQDVVSWNALSSRYLEHGFDEEA 6
L+ +Y RC L +AR+VF ++ +D+ SWNA+ + Y++HG + A
Sbjct: 494 ALISMYGRCGKLADAREVFYRIRRRDLGSWNAMIAAYVQHGANGSA 539



Score = 106 bits (264), Expect = 7e-22
Identities = 53/166 (31%), Positives = 95/166 (57%)
Frame = -1

Query: 500 IHIEVTKEGLERDPLVGSALVGIYARSGALIDALKIFDKLCSRNVVSWTALISGYADHCF 321
IH ++ + G+ + LV +AL+ +Y R G L DA ++F ++ R++ SW A+I+ Y H
Sbjct: 476 IHGKIDQWGMLSNNLVANALISMYGRCGKLADAREVFYRIRRRDLGSWNAMIAAYVQHGA 535

Query: 320 GAEALNCLKEMQADGVAPNDVTFVCGLKACGQIGALDRGRELHSMIAIEGFERDTFVGNT 141
A + + +++G + TF+ L+A + LD GR++H ++ G E+D + T
Sbjct: 536 NGSAFDLFIKYKSEGGKGDKYTFINVLRAIANLEDLDAGRKIHGLVEKAGLEKDIRILTT 595

Query: 140 LVDVYARCVMLLEARDVFDELQVQDVVSWNALSSRYLEHGFDEEAL 3
L+ +Y++C L +A VF +Q +DVV WNA+ + Y ++AL
Sbjct: 596 LIKMYSKCGSLRDAYSVFKNVQEKDVVCWNAMLAAYNHSDHGQDAL 641



Score = 94.0 bits (232), Expect = 4e-18
Identities = 47/153 (30%), Positives = 85/153 (55%), Gaps = 1/153 (0%)
Frame = -1

Query: 500 IHIEVTKEGLERDPLVGSALVGIYARSGALIDALKIFDKLCSRNVVSWTALISGYADHCF 321
IH V K GLE+D + + L+ +Y++ G+L DA +F + ++VV W A+++ Y
Sbjct: 577 IHGLVEKAGLEKDIRILTTLIKMYSKCGSLRDAYSVFKNVQEKDVVCWNAMLAAYNHSDH 636

Query: 320 GAEALNCLKEMQADGVAPNDVTFVCGLKACGQIGALDRGRELHSMIAIEGFERDTFVGNT 141
G +AL ++M+ +GV P+ T+ L AC ++GA++ G++ H+ + E DT
Sbjct: 637 GQDALKLFQQMRLEGVNPDSATYTSVLNACARLGAIEHGKKFHTQLKEAAMETDTRHYAC 696

Query: 140 LVDVYARCVMLLEARDVFDELQVQ-DVVSWNAL 45
+V R +L EA + +E+ + D + W +L
Sbjct: 697 MVAALGRASLLKEAEEFIEEISSESDALMWESL 729



Score = 65.9 bits (159), Expect = 1e-09
Identities = 32/92 (34%), Positives = 54/92 (58%)
Frame = -1

Query: 278 GVAPNDVTFVCGLKACGQIGALDRGRELHSMIAIEGFERDTFVGNTLVDVYARCVMLLEA 99
GV N + L+ C Q +L G+++H + FE D ++ N L+ +Y++C + +A
Sbjct: 46 GVQANLNFYARRLQECVQAKSLAEGKKVHDHMRSAQFEPDIYLNNMLISMYSKCGSIEDA 105

Query: 98 RDVFDELQVQDVVSWNALSSRYLEHGFDEEAL 3
+VF ++ +DVVSWNA+ S Y HG +EA+
Sbjct: 106 NNVFQSMEDKDVVSWNAMISGYALHGRGQEAV 137


>tr|A9T480|A9T480_PHYPA Predicted protein (Fragment)
OS=Physcomitrella patens subsp. patens
GN=PHYPADRAFT_140042 PE=4 SV=1
Length = 748

Score = 134 bits (337), Expect = 2e-30
Identities = 69/167 (41%), Positives = 102/167 (61%), Gaps = 1/167 (0%)
Frame = -1

Query: 503 DIHIEVTKEGLERDPLVGSALVGIYARSGALIDALKIFDKLCSRNVVSWTALISGYADHC 324
++H + GLE D VG+ALV +YARSG++ DA +FDK+ RN+++W ++I G A H
Sbjct: 228 EVHSHALRAGLESDVRVGTALVHMYARSGSIKDARLVFDKMTERNIITWNSMIGGLAQHG 287

Query: 323 FGAEALNCLKEMQADGVAPNDVTFVCGL-KACGQIGALDRGRELHSMIAIEGFERDTFVG 147
G EA + ++MQ +G+ P+ +T+V L AC GAL R++H A G + D VG
Sbjct: 288 CGLEAFSLFRQMQREGLVPDAITYVNILNNACASTGALQWVRKVHDDAAKVGLDFDVRVG 347

Query: 146 NTLVDVYARCVMLLEARDVFDELQVQDVVSWNALSSRYLEHGFDEEA 6
N LV +YA+C + +AR VF + +DVVSW + +HGF EA
Sbjct: 348 NALVHMYAKCGSMDDARRVFYGMVDRDVVSWTVMIGGLAQHGFGREA 394



Score = 126 bits (317), Expect = 5e-28
Identities = 62/165 (37%), Positives = 100/165 (60%)
Frame = -1

Query: 500 IHIEVTKEGLERDPLVGSALVGIYARSGALIDALKIFDKLCSRNVVSWTALISGYADHCF 321
+H + K +E+ P V + L+ IY R G L + ++FD L +NV +WT +I GYA++
Sbjct: 27 VHECIIKSEMEQHPYVANKLMSIYIRCGRLQNTREVFDTLVEKNVFNWTIMIGGYAENNH 86

Query: 320 GAEALNCLKEMQADGVAPNDVTFVCGLKACGQIGALDRGRELHSMIAIEGFERDTFVGNT 141
+A+ +M+ +GV PN++TF LKAC AL GR++H I GF+ D +GN
Sbjct: 87 FEDAIEVYNKMRQNGVQPNEITFFNILKACTSPMALKWGRKIHDHIRHAGFQSDLRLGNA 146

Query: 140 LVDVYARCVMLLEARDVFDELQVQDVVSWNALSSRYLEHGFDEEA 6
L+ +YARC + +AR VF+ + +D+++WN + R ++HG EA
Sbjct: 147 LIHMYARCGSMDDARLVFNGMVDRDIITWNVMIGRLVQHGRGHEA 191



Score = 123 bits (308), Expect = 6e-27
Identities = 62/165 (37%), Positives = 97/165 (58%)
Frame = -1

Query: 500 IHIEVTKEGLERDPLVGSALVGIYARSGALIDALKIFDKLCSRNVVSWTALISGYADHCF 321
+H + K GL+ D VG+ALV +YA+ G++ DA ++F + R+VVSWT +I G A H F
Sbjct: 331 VHDDAAKVGLDFDVRVGNALVHMYAKCGSMDDARRVFYGMVDRDVVSWTVMIGGLAQHGF 390

Query: 320 GAEALNCLKEMQADGVAPNDVTFVCGLKACGQIGALDRGRELHSMIAIEGFERDTFVGNT 141
G EA + +MQ +G PN T++ L GAL+ +E+H+ + VGN
Sbjct: 391 GREAFSLFLQMQREGFVPNLTTYLSILNGKASTGALEWVKEVHTHAVNAELDSHLRVGNA 450

Query: 140 LVDVYARCVMLLEARDVFDELQVQDVVSWNALSSRYLEHGFDEEA 6
L+ +YA+C + AR VFD ++ +D++SWNA+ ++G EA
Sbjct: 451 LIHMYAKCGSIENARLVFDRMEDRDIISWNAMIGGLAQNGHGREA 495



Score = 120 bits (301), Expect = 4e-26
Identities = 60/166 (36%), Positives = 96/166 (57%)
Frame = -1

Query: 503 DIHIEVTKEGLERDPLVGSALVGIYARSGALIDALKIFDKLCSRNVVSWTALISGYADHC 324
++H L+ VG+AL+ +YA+ G++ +A +FD++ R+++SW A+I G A +
Sbjct: 431 EVHTHAVNAELDSHLRVGNALIHMYAKCGSIENARLVFDRMEDRDIISWNAMIGGLAQNG 490

Query: 323 FGAEALNCLKEMQADGVAPNDVTFVCGLKACGQIGALDRGRELHSMIAIEGFERDTFVGN 144
G EA + EMQ +G P+ T V L AC ALDR +E+HS G E D VG+
Sbjct: 491 HGREAFSHFLEMQREGFIPDAATLVSILNACASTRALDRVKEVHSHALEAGLESDLRVGS 550

Query: 143 TLVDVYARCVMLLEARDVFDELQVQDVVSWNALSSRYLEHGFDEEA 6
LV YA+C + +AR VF+ + +D+++WN + +HG + EA
Sbjct: 551 ALVHTYAKCGRIDDARLVFEGMASRDIITWNVMIGGLAQHGREHEA 596



Score = 107 bits (268), Expect = 2e-22
Identities = 55/165 (33%), Positives = 92/165 (55%)
Frame = -1

Query: 500 IHIEVTKEGLERDPLVGSALVGIYARSGALIDALKIFDKLCSRNVVSWTALISGYADHCF 321
IH + G + D +G+AL+ +YAR G++ DA +F+ + R++++W +I H
Sbjct: 128 IHDHIRHAGFQSDLRLGNALIHMYARCGSMDDARLVFNGMVDRDIITWNVMIGRLVQHGR 187

Query: 320 GAEALNCLKEMQADGVAPNDVTFVCGLKACGQIGALDRGRELHSMIAIEGFERDTFVGNT 141
G EA + +MQ +G P+ T++ L A GAL +E+HS G E D VG
Sbjct: 188 GHEAFSLFLQMQREGFVPDTTTYLSMLNANACTGALGWVKEVHSHALRAGLESDVRVGTA 247

Query: 140 LVDVYARCVMLLEARDVFDELQVQDVVSWNALSSRYLEHGFDEEA 6
LV +YAR + +AR VFD++ +++++WN++ +HG EA
Sbjct: 248 LVHMYARSGSIKDARLVFDKMTERNIITWNSMIGGLAQHGCGLEA 292



Score = 89.0 bits (219), Expect = 1e-16
Identities = 54/169 (31%), Positives = 86/169 (50%), Gaps = 2/169 (1%)
Frame = -1

Query: 503 DIHIEVTKEGLERDPLVGSALVGIYARSGALIDALKIFDKLCSRNVVSWTALISGYADHC 324
++H + GLE D VGSALV YA+ G + DA +F+ + SR++++W +I G A H
Sbjct: 532 EVHSHALEAGLESDLRVGSALVHTYAKCGRIDDARLVFEGMASRDIITWNVMIGGLAQHG 591

Query: 323 FGAEALNCLKEMQADGVAPNDVTFVCGLKACGQIGALDRGRELHSMIAIEGFERDTFVGN 144
EA + +MQ G P+ +T++ L I AL+ +E+H GF+ D V +
Sbjct: 592 REHEAFSLFLQMQDVGFVPDAITYLSILGGNVSIEALEWVKEVHRHAVRAGFDTDPRVSS 651

Query: 143 TLVDVYARCVMLLEARDVFDELQVQDV--VSWNALSSRYLEHGFDEEAL 3
LV +Y +C + A+ F + D+ +W L HG E A+
Sbjct: 652 ALVHMYTKCGDIDNAKLHFTPNMLPDLDGTAWGDLLDACRNHGDVEMAV 700



Score = 46.6 bits (109), Expect = 7e-04
Identities = 21/67 (31%), Positives = 36/67 (53%)
Frame = -1

Query: 203 RELHSMIAIEGFERDTFVGNTLVDVYARCVMLLEARDVFDELQVQDVVSWNALSSRYLEH 24
+++H I E+ +V N L+ +Y RC L R+VFD L ++V +W + Y E+
Sbjct: 25 KQVHECIIKSEMEQHPYVANKLMSIYIRCGRLQNTREVFDTLVEKNVFNWTIMIGGYAEN 84

Query: 23 GFDEEAL 3
E+A+
Sbjct: 85 NHFEDAI 91


>tr|A5B2K7|A5B2K7_VITVI Putative uncharacterized protein OS=Vitis
vinifera GN=VITISV_023708 PE=4 SV=1
Length = 906

Score = 133 bits (335), Expect = 4e-30
Identities = 69/166 (41%), Positives = 102/166 (61%)
Frame = -1

Query: 500 IHIEVTKEGLERDPLVGSALVGIYARSGALIDALKIFDKLCSRNVVSWTALISGYADHCF 321
IH +TK GL DP + + L+ +Y++ A K+ D+ ++VSW+ALISGYA +
Sbjct: 78 IHAHITKSGLSDDPSIRNHLINLYSKCRXFGYARKLVDESSEPDLVSWSALISGYAQNGL 137

Query: 320 GAEALNCLKEMQADGVAPNDVTFVCGLKACGQIGALDRGRELHSMIAIEGFERDTFVGNT 141
G AL EM GV N+ TF LKAC + L G+++H ++ + GFE D FV NT
Sbjct: 138 GGGALMAFHEMHLLGVKCNEFTFSSVLKACSIVKDLRIGKQVHGVVVVSGFEGDVFVANT 197

Query: 140 LVDVYARCVMLLEARDVFDELQVQDVVSWNALSSRYLEHGFDEEAL 3
LV +YA+C L+++ +FDE+ ++VVSWNAL S Y++ F EA+
Sbjct: 198 LVVMYAKCDEFLDSKRLFDEIPERNVVSWNALFSCYVQXDFCGEAV 243



Score = 111 bits (278), Expect = 2e-23
Identities = 59/166 (35%), Positives = 92/166 (55%)
Frame = -1

Query: 500 IHIEVTKEGLERDPLVGSALVGIYARSGALIDALKIFDKLCSRNVVSWTALISGYADHCF 321
+H V G E D V + LV +YA+ +D+ ++FD++ RNVVSW AL S Y F
Sbjct: 179 VHGVVVVSGFEGDVFVANTLVVMYAKCDEFLDSKRLFDEIPERNVVSWNALFSCYVQXDF 238

Query: 320 GAEALNCLKEMQADGVAPNDVTFVCGLKACGQIGALDRGRELHSMIAIEGFERDTFVGNT 141
EA+ EM G+ PN+ + + AC + RG+ +H + G++ D F N
Sbjct: 239 CGEAVGLFYEMVLSGIKPNEFSLSSMVNACTGLRDSSRGKIIHGYLIKLGYDWDPFSANA 298

Query: 140 LVDVYARCVMLLEARDVFDELQVQDVVSWNALSSRYLEHGFDEEAL 3
LVD+YA+ L +A VF++++ D+VSWNA+ + + H E+AL
Sbjct: 299 LVDMYAKVGDLADAISVFEKIKQPDIVSWNAVIAGCVLHEHHEQAL 344



Score = 103 bits (256), Expect = 6e-21
Identities = 59/168 (35%), Positives = 94/168 (55%), Gaps = 2/168 (1%)
Frame = -1

Query: 500 IHIEVTKEGLERDPLVGSALVGIYARSGALIDALKIFDKLCSRNVVSWTALISGYADHCF 321
+H K G D V ++L+ Y + + DA +IF++ ++VS+T++I+ YA +
Sbjct: 455 VHGLSVKSGFHSDIYVVNSLIDSYGKCSHVEDAERIFEECTIGDLVSFTSMITAYAQYGQ 514

Query: 320 GAEALNCLKEMQADGVAPNDVTFVCG--LKACGQIGALDRGRELHSMIAIEGFERDTFVG 147
G EAL EMQ + P+ FVC L AC + A ++G++LH I GF D F G
Sbjct: 515 GEEALKLFLEMQDMELKPD--RFVCSSLLNACANLSAFEQGKQLHVHILKYGFVLDIFAG 572

Query: 146 NTLVDVYARCVMLLEARDVFDELQVQDVVSWNALSSRYLEHGFDEEAL 3
N+LV++YA+C + +A F EL + +VSW+A+ +HG +AL
Sbjct: 573 NSLVNMYAKCGSIDDAGRAFSELTERGIVSWSAMIGGLAQHGHGRQAL 620



Score = 101 bits (252), Expect = 2e-20
Identities = 52/166 (31%), Positives = 92/166 (55%)
Frame = -1

Query: 500 IHIEVTKEGLERDPLVGSALVGIYARSGALIDALKIFDKLCSRNVVSWTALISGYADHCF 321
+H + K +E D V LV +Y++ L DA F+ L +++++W A+ISGY+ +
Sbjct: 354 LHSSLMKMDMESDLFVSVGLVDMYSKCDLLEDARMAFNLLPEKDLIAWNAIISGYSQYWE 413

Query: 320 GAEALNCLKEMQADGVAPNDVTFVCGLKACGQIGALDRGRELHSMIAIEGFERDTFVGNT 141
EAL+ EM +G+ N T LK+ + + R++H + GF D +V N+
Sbjct: 414 DMEALSLFVEMHKEGIGFNQTTLSTILKSTAGLQVVHVCRQVHGLSVKSGFHSDIYVVNS 473

Query: 140 LVDVYARCVMLLEARDVFDELQVQDVVSWNALSSRYLEHGFDEEAL 3
L+D Y +C + +A +F+E + D+VS+ ++ + Y ++G EEAL
Sbjct: 474 LIDSYGKCSHVEDAERIFEECTIGDLVSFTSMITAYAQYGQGEEAL 519



Score = 92.0 bits (227), Expect = 1e-17
Identities = 56/166 (33%), Positives = 87/166 (52%)
Frame = -1

Query: 500 IHIEVTKEGLERDPLVGSALVGIYARSGALIDALKIFDKLCSRNVVSWTALISGYADHCF 321
IH + K G + DP +ALV +YA+ G L DA+ +F+K+ ++VSW A+I+G H
Sbjct: 280 IHGYLIKLGYDWDPFSANALVDMYAKVGDLADAISVFEKIKQPDIVSWNAVIAGCVLHEH 339

Query: 320 GAEALNCLKEMQADGVAPNDVTFVCGLKACGQIGALDRGRELHSMIAIEGFERDTFVGNT 141
+AL L +M+ R+LHS + E D FV
Sbjct: 340 HEQALELLGQMK---------------------------RQLHSSLMKMDMESDLFVSVG 372

Query: 140 LVDVYARCVMLLEARDVFDELQVQDVVSWNALSSRYLEHGFDEEAL 3
LVD+Y++C +L +AR F+ L +D+++WNA+ S Y ++ D EAL
Sbjct: 373 LVDMYSKCDLLEDARMAFNLLPEKDLIAWNAIISGYSQYWEDMEAL 418



Score = 86.3 bits (212), Expect = 8e-16
Identities = 49/154 (31%), Positives = 82/154 (53%), Gaps = 2/154 (1%)
Frame = -1

Query: 500 IHIEVTKEGLERDPLVGSALVGIYARSGALIDALKIFDKLCSRNVVSWTALISGYADHCF 321
+H+ + K G D G++LV +YA+ G++ DA + F +L R +VSW+A+I G A H
Sbjct: 556 LHVHILKYGFVLDIFAGNSLVNMYAKCGSIDDAGRAFSELTERGIVSWSAMIGGLAQHGH 615

Query: 320 GAEALNCLKEMQADGVAPNDVTFVCGLKACGQIGALDRGR-ELHSMIAIEGFERDTFVGN 144
G +AL +M +GV+PN +T V L AC G + + SM + GF+
Sbjct: 616 GRQALQLFNQMLKEGVSPNHITLVSVLGACNHAGLVTEAKLYFESMEELFGFKPMQEHYA 675

Query: 143 TLVDVYARCVMLLEARDVFDELQVQDVVS-WNAL 45
++D+ R + EA ++ +++ + S W AL
Sbjct: 676 CMIDLLGRAGKINEAVELVNKMPFEANASVWGAL 709



Score = 52.8 bits (125), Expect = 9e-06
Identities = 29/89 (32%), Positives = 46/89 (51%)
Frame = -1

Query: 269 PNDVTFVCGLKACGQIGALDRGRELHSMIAIEGFERDTFVGNTLVDVYARCVMLLEARDV 90
P V++ L C +L G ++H+ I G D + N L+++Y++C AR +
Sbjct: 54 PTSVSYSKLLSQCCTTKSLRPGLQIHAHITKSGLSDDPSIRNHLINLYSKCRXFGYARKL 113

Query: 89 FDELQVQDVVSWNALSSRYLEHGFDEEAL 3
DE D+VSW+AL S Y ++G AL
Sbjct: 114 VDESSEPDLVSWSALISGYAQNGLGGGAL 142


>tr|Q5W965|Q5W965_PHYPA PPR868-14 OS=Physcomitrella patens PE=2 SV=1
Length = 868

Score = 133 bits (334), Expect = 5e-30
Identities = 67/167 (40%), Positives = 103/167 (61%), Gaps = 1/167 (0%)
Frame = -1

Query: 500 IHIEVTKEGLERDPLVGSALVGIYARSGALIDALKIFDKLCSRNVVSWTALISGYADHCF 321
IH V G+E D V +AL+ +Y++ G + A ++F K+ RNVVSWTA+I A H
Sbjct: 179 IHTIVKAMGMETDVAVATALITMYSKCGEISVACEVFHKMTERNVVSWTAIIQANAQHRK 238

Query: 320 GAEALNCLKEMQADGVAPNDVTFVCGLKACGQIGALDRGRELHSMIAIEGFERDTFVGNT 141
EA ++M G++PN VTFV L +C AL+RGR +HS I+ G E D V N
Sbjct: 239 LNEAFELYEQMLQAGISPNAVTFVSLLNSCNTPEALNRGRRIHSHISERGLETDMIVANA 298

Query: 140 LVDVYARCVMLLEARDVFDELQVQDVVSWNALSSRYLEHGF-DEEAL 3
L+ +Y +C + EAR++FD + +DV+SW+A+ + Y + G+ D+E++
Sbjct: 299 LITMYCKCNSVQEAREIFDRMSKRDVISWSAMIAGYAQSGYKDKESI 345



Score = 123 bits (308), Expect = 6e-27
Identities = 59/165 (35%), Positives = 105/165 (63%), Gaps = 5/165 (3%)
Frame = -1

Query: 500 IHIEVTKEGLERDPLVGSALVGIYARSGALIDALKIFDKLCSRNVVSWTALISGYADHCF 321
IH +++ GLE D +V +AL+ +Y + ++ +A +IFD++ R+V+SW+A+I+GYA +
Sbjct: 280 IHSHISERGLETDMIVANALITMYCKCNSVQEAREIFDRMSKRDVISWSAMIAGYAQSGY 339

Query: 320 GA-----EALNCLKEMQADGVAPNDVTFVCGLKACGQIGALDRGRELHSMIAIEGFERDT 156
E L+ M+ +GV PN VTF+ L+AC GAL++GR++H+ ++ GFE D
Sbjct: 340 KDKESIDEVFQLLERMRREGVFPNKVTFMSILRACTAHGALEQGRQIHAELSKVGFELDR 399

Query: 155 FVGNTLVDVYARCVMLLEARDVFDELQVQDVVSWNALSSRYLEHG 21
+ + ++YA+C + EA VF ++ ++VV+W + S Y++ G
Sbjct: 400 SLQTAIFNMYAKCGSIYEAEQVFSKMANKNVVAWTSFLSMYIKCG 444



Score = 116 bits (291), Expect = 5e-25
Identities = 62/197 (31%), Positives = 107/197 (54%), Gaps = 31/197 (15%)
Frame = -1

Query: 500 IHIEVTKEGLERDPLVGSALVGIYARSGALIDALKIFDKLCSRNVVSWTA---------- 351
IH E++K G E D + +A+ +YA+ G++ +A ++F K+ ++NVV+WT+
Sbjct: 386 IHAELSKVGFELDRSLQTAIFNMYAKCGSIYEAEQVFSKMANKNVVAWTSFLSMYIKCGD 445

Query: 350 ---------------------LISGYADHCFGAEALNCLKEMQADGVAPNDVTFVCGLKA 234
+I+GYA + + L M+A+G P+ VT + L+A
Sbjct: 446 LSSAEKVFSEMPTRNVVSWNLMIAGYAQNGDIVKVFELLSSMKAEGFQPDRVTVITILEA 505

Query: 233 CGQIGALDRGRELHSMIAIEGFERDTFVGNTLVDVYARCVMLLEARDVFDELQVQDVVSW 54
CG + L+RG+ +H+ G E DT V +L+ +Y++C + EAR VFD++ +D V+W
Sbjct: 506 CGALAGLERGKLVHAEAVKLGLESDTVVATSLIGMYSKCGQVAEARTVFDKMSNRDTVAW 565

Query: 53 NALSSRYLEHGFDEEAL 3
NA+ + Y +HG EA+
Sbjct: 566 NAMLAGYGQHGDGLEAV 582



Score = 103 bits (257), Expect = 5e-21
Identities = 47/159 (29%), Positives = 95/159 (59%)
Frame = -1

Query: 500 IHIEVTKEGLERDPLVGSALVGIYARSGALIDALKIFDKLCSRNVVSWTALISGYADHCF 321
+H ++ + G+E D +G++L+ Y++ + A ++F ++ R+VV+W+++I+ YA +
Sbjct: 78 VHKQLDELGVEIDIYLGNSLINFYSKFEDVASAEQVFRRMTLRDVVTWSSMIAAYAGNNH 137

Query: 320 GAEALNCLKEMQADGVAPNDVTFVCGLKACGQIGALDRGRELHSMIAIEGFERDTFVGNT 141
A+A + + M + PN +TF+ LKAC L++GR++H+++ G E D V
Sbjct: 138 PAKAFDTFERMTDANIEPNRITFLSILKACNNYSILEKGRKIHTIVKAMGMETDVAVATA 197

Query: 140 LVDVYARCVMLLEARDVFDELQVQDVVSWNALSSRYLEH 24
L+ +Y++C + A +VF ++ ++VVSW A+ +H
Sbjct: 198 LITMYSKCGEISVACEVFHKMTERNVVSWTAIIQANAQH 236



Score = 101 bits (251), Expect = 2e-20
Identities = 54/163 (33%), Positives = 91/163 (55%), Gaps = 4/163 (2%)
Frame = -1

Query: 500 IHIEVTKEGLERDPLVGSALVGIYARSGALIDALKIFDKLCSRNVVSWTALISGYADHCF 321
+H E K GLE D +V ++L+G+Y++ G + +A +FDK+ +R+ V+W A+++GY H
Sbjct: 518 VHAEAVKLGLESDTVVATSLIGMYSKCGQVAEARTVFDKMSNRDTVAWNAMLAGYGQHGD 577

Query: 320 GAEALNCLKEMQADGVAPNDVTFVCGLKACGQIGALDRGRELHSMIAIEGFE---RDTFV 150
G EA++ K M + V+PN++T + AC + G + GRE+ M+ E F+ R
Sbjct: 578 GLEAVDLFKRMLKERVSPNEITLTAVISACSRAGLVQEGREIFRMMQ-EDFKMTPRKQHY 636

Query: 149 GNTLVDVYARCVMLLEARDVFDELQVQ-DVVSWNALSSRYLEH 24
G +VD+ R L EA + + + D+ W+AL H
Sbjct: 637 G-CMVDLLGRAGRLQEAEEFIQSMPCEPDISVWHALLGACKSH 678



Score = 55.1 bits (131), Expect = 2e-06
Identities = 25/94 (26%), Positives = 53/94 (56%)
Frame = -1

Query: 314 EALNCLKEMQADGVAPNDVTFVCGLKACGQIGALDRGRELHSMIAIEGFERDTFVGNTLV 135
EA+ L ++ G+ N T+ C ++ C + + G+ +H + G E D ++GN+L+
Sbjct: 39 EAIQLLGIIKQRGLLVNSNTYGCVIEHCAKARRFEDGKMVHKQLDELGVEIDIYLGNSLI 98

Query: 134 DVYARCVMLLEARDVFDELQVQDVVSWNALSSRY 33
+ Y++ + A VF + ++DVV+W+++ + Y
Sbjct: 99 NFYSKFEDVASAEQVFRRMTLRDVVTWSSMIAAY 132


>tr|B8LQA8|B8LQA8_PICSI Putative uncharacterized protein OS=Picea
sitchensis PE=2 SV=1
Length = 795

Score = 133 bits (334), Expect = 5e-30
Identities = 67/166 (40%), Positives = 99/166 (59%)
Frame = -1

Query: 500 IHIEVTKEGLERDPLVGSALVGIYARSGALIDALKIFDKLCSRNVVSWTALISGYADHCF 321
IH + G E + +VG+ALV +YA+ G + A K+F+++ +NVV+W A+ISGY+ H
Sbjct: 344 IHGYAIRSGFESNDVVGNALVNMYAKCGNVNSAYKLFERMPKKNVVAWNAIISGYSQHGH 403

Query: 320 GAEALNCLKEMQADGVAPNDVTFVCGLKACGQIGALDRGRELHSMIAIEGFERDTFVGNT 141
EAL EMQA G+ P+ V L AC AL++G+++H GFE + VG
Sbjct: 404 PHEALALFIEMQAQGIKPDSFAIVSVLPACAHFLALEQGKQIHGYTIRSGFESNVVVGTG 463

Query: 140 LVDVYARCVMLLEARDVFDELQVQDVVSWNALSSRYLEHGFDEEAL 3
LVD+YA+C + A+ +F+ + QDVVSW + Y HG E+AL
Sbjct: 464 LVDIYAKCGNVNTAQKLFERMPEQDVVSWTTMILAYGIHGHGEDAL 509



Score = 129 bits (323), Expect = 1e-28
Identities = 65/166 (39%), Positives = 100/166 (60%)
Frame = -1

Query: 500 IHIEVTKEGLERDPLVGSALVGIYARSGALIDALKIFDKLCSRNVVSWTALISGYADHCF 321
IH + G+E D LV + LV +YA+ G + A K+F+++ R+V SW A+I GY+ +
Sbjct: 243 IHCYAIRSGIESDVLVVNGLVNMYAKCGNVNTAHKLFERMPIRDVASWNAIIGGYSLNSQ 302

Query: 320 GAEALNCLKEMQADGVAPNDVTFVCGLKACGQIGALDRGRELHSMIAIEGFERDTFVGNT 141
EAL MQ G+ PN +T V L AC + AL++G+++H GFE + VGN
Sbjct: 303 HHEALAFFNRMQVRGIKPNSITMVSVLPACAHLFALEQGQQIHGYAIRSGFESNDVVGNA 362

Query: 140 LVDVYARCVMLLEARDVFDELQVQDVVSWNALSSRYLEHGFDEEAL 3
LV++YA+C + A +F+ + ++VV+WNA+ S Y +HG EAL
Sbjct: 363 LVNMYAKCGNVNSAYKLFERMPKKNVVAWNAIISGYSQHGHPHEAL 408



Score = 126 bits (317), Expect = 5e-28
Identities = 61/166 (36%), Positives = 99/166 (59%)
Frame = -1

Query: 500 IHIEVTKEGLERDPLVGSALVGIYARSGALIDALKIFDKLCSRNVVSWTALISGYADHCF 321
+H ++ G E D +VG+AL +Y + G+L +A ++FD++ R+VVSW A+I+GY+ +
Sbjct: 142 VHEDIIARGFESDVIVGTALASMYTKCGSLENARQVFDRMPKRDVVSWNAIIAGYSQNGQ 201

Query: 320 GAEALNCLKEMQADGVAPNDVTFVCGLKACGQIGALDRGRELHSMIAIEGFERDTFVGNT 141
EAL EMQ +G+ PN T V + C + AL++G+++H G E D V N
Sbjct: 202 PYEALALFSEMQVNGIKPNSSTLVSVMPVCAHLLALEQGKQIHCYAIRSGIESDVLVVNG 261

Query: 140 LVDVYARCVMLLEARDVFDELQVQDVVSWNALSSRYLEHGFDEEAL 3
LV++YA+C + A +F+ + ++DV SWNA+ Y + EAL
Sbjct: 262 LVNMYAKCGNVNTAHKLFERMPIRDVASWNAIIGGYSLNSQHHEAL 307



Score = 98.2 bits (243), Expect = 2e-19
Identities = 50/123 (40%), Positives = 68/123 (55%)
Frame = -1

Query: 371 NVVSWTALISGYADHCFGAEALNCLKEMQADGVAPNDVTFVCGLKACGQIGALDRGRELH 192
N V W I GY + F +AL +MQ G+ P+ + F+ +KACG L GR++H
Sbjct: 84 NAVVWKETIIGYVKNGFWNKALRLYYQMQRTGINPDKLVFLSVIKACGSQSDLQAGRKVH 143

Query: 191 SMIAIEGFERDTFVGNTLVDVYARCVMLLEARDVFDELQVQDVVSWNALSSRYLEHGFDE 12
I GFE D VG L +Y +C L AR VFD + +DVVSWNA+ + Y ++G
Sbjct: 144 EDIIARGFESDVIVGTALASMYTKCGSLENARQVFDRMPKRDVVSWNAIIAGYSQNGQPY 203

Query: 11 EAL 3
EAL
Sbjct: 204 EAL 206



Score = 75.9 bits (185), Expect = 1e-12
Identities = 49/154 (31%), Positives = 75/154 (48%), Gaps = 2/154 (1%)
Frame = -1

Query: 500 IHIEVTKEGLERDPLVGSALVGIYARSGALIDALKIFDKLCSRNVVSWTALISGYADHCF 321
IH + G E + +VG+ LV IYA+ G + A K+F+++ ++VVSWT +I Y H
Sbjct: 445 IHGYTIRSGFESNVVVGTGLVDIYAKCGNVNTAQKLFERMPEQDVVSWTTMILAYGIHGH 504

Query: 320 GAEALNCLKEMQADGVAPNDVTFVCGLKACGQIGALDRGRE-LHSMIAIEGFERDTFVGN 144
G +AL +MQ G + + F L AC G +D+G + M + G
Sbjct: 505 GEDALALFSKMQETGTKLDHIAFTAILTACSHAGLVDQGLQYFQCMKSDYGLAPKLEHYA 564

Query: 143 TLVDVYARCVMLLEARDVFDELQVQ-DVVSWNAL 45
LVD+ R L EA + + ++ D W AL
Sbjct: 565 CLVDLLGRAGHLDEANGIIKNMSLEPDANVWGAL 598


>tr|A9SDQ1|A9SDQ1_PHYPA Predicted protein OS=Physcomitrella patens
subsp. patens GN=PHYPADRAFT_211228 PE=4 SV=1
Length = 868

Score = 133 bits (334), Expect = 5e-30
Identities = 67/167 (40%), Positives = 103/167 (61%), Gaps = 1/167 (0%)
Frame = -1

Query: 500 IHIEVTKEGLERDPLVGSALVGIYARSGALIDALKIFDKLCSRNVVSWTALISGYADHCF 321
IH V G+E D V +AL+ +Y++ G + A ++F K+ RNVVSWTA+I A H
Sbjct: 179 IHTIVKAMGMETDVAVATALITMYSKCGEISVACEVFHKMTERNVVSWTAIIQANAQHRK 238

Query: 320 GAEALNCLKEMQADGVAPNDVTFVCGLKACGQIGALDRGRELHSMIAIEGFERDTFVGNT 141
EA ++M G++PN VTFV L +C AL+RGR +HS I+ G E D V N
Sbjct: 239 LNEAFELYEQMLQAGISPNAVTFVSLLNSCNTPEALNRGRRIHSHISERGLETDMIVANA 298

Query: 140 LVDVYARCVMLLEARDVFDELQVQDVVSWNALSSRYLEHGF-DEEAL 3
L+ +Y +C + EAR++FD + +DV+SW+A+ + Y + G+ D+E++
Sbjct: 299 LITMYCKCNSVQEAREIFDRMSKRDVISWSAMIAGYAQSGYKDKESI 345



Score = 123 bits (308), Expect = 6e-27
Identities = 59/165 (35%), Positives = 105/165 (63%), Gaps = 5/165 (3%)
Frame = -1

Query: 500 IHIEVTKEGLERDPLVGSALVGIYARSGALIDALKIFDKLCSRNVVSWTALISGYADHCF 321
IH +++ GLE D +V +AL+ +Y + ++ +A +IFD++ R+V+SW+A+I+GYA +
Sbjct: 280 IHSHISERGLETDMIVANALITMYCKCNSVQEAREIFDRMSKRDVISWSAMIAGYAQSGY 339

Query: 320 GA-----EALNCLKEMQADGVAPNDVTFVCGLKACGQIGALDRGRELHSMIAIEGFERDT 156
E L+ M+ +GV PN VTF+ L+AC GAL++GR++H+ ++ GFE D
Sbjct: 340 KDKESIDEVFQLLERMRREGVFPNKVTFMSILRACTAHGALEQGRQIHAELSKVGFELDR 399

Query: 155 FVGNTLVDVYARCVMLLEARDVFDELQVQDVVSWNALSSRYLEHG 21
+ + ++YA+C + EA VF ++ ++VV+W + S Y++ G
Sbjct: 400 SLQTAIFNMYAKCGSIYEAEQVFSKMANKNVVAWTSFLSMYIKCG 444



Score = 116 bits (291), Expect = 5e-25
Identities = 62/197 (31%), Positives = 107/197 (54%), Gaps = 31/197 (15%)
Frame = -1

Query: 500 IHIEVTKEGLERDPLVGSALVGIYARSGALIDALKIFDKLCSRNVVSWTA---------- 351
IH E++K G E D + +A+ +YA+ G++ +A ++F K+ ++NVV+WT+
Sbjct: 386 IHAELSKVGFELDRSLQTAIFNMYAKCGSIYEAEQVFSKMANKNVVAWTSFLSMYIKCGD 445

Query: 350 ---------------------LISGYADHCFGAEALNCLKEMQADGVAPNDVTFVCGLKA 234
+I+GYA + + L M+A+G P+ VT + L+A
Sbjct: 446 LSSAEKVFSEMPTRNVVSWNLMIAGYAQNGDIVKVFELLSSMKAEGFQPDRVTVITILEA 505

Query: 233 CGQIGALDRGRELHSMIAIEGFERDTFVGNTLVDVYARCVMLLEARDVFDELQVQDVVSW 54
CG + L+RG+ +H+ G E DT V +L+ +Y++C + EAR VFD++ +D V+W
Sbjct: 506 CGALAGLERGKLVHAEAVKLGLESDTVVATSLIGMYSKCGQVAEARTVFDKMSNRDTVAW 565

Query: 53 NALSSRYLEHGFDEEAL 3
NA+ + Y +HG EA+
Sbjct: 566 NAMLAGYGQHGDGLEAV 582



Score = 103 bits (257), Expect = 5e-21
Identities = 47/159 (29%), Positives = 95/159 (59%)
Frame = -1

Query: 500 IHIEVTKEGLERDPLVGSALVGIYARSGALIDALKIFDKLCSRNVVSWTALISGYADHCF 321
+H ++ + G+E D +G++L+ Y++ + A ++F ++ R+VV+W+++I+ YA +
Sbjct: 78 VHKQLDELGVEIDIYLGNSLINFYSKFEDVASAEQVFRRMTLRDVVTWSSMIAAYAGNNH 137

Query: 320 GAEALNCLKEMQADGVAPNDVTFVCGLKACGQIGALDRGRELHSMIAIEGFERDTFVGNT 141
A+A + + M + PN +TF+ LKAC L++GR++H+++ G E D V
Sbjct: 138 PAKAFDTFERMTDANIEPNRITFLSILKACNNYSILEKGRKIHTIVKAMGMETDVAVATA 197

Query: 140 LVDVYARCVMLLEARDVFDELQVQDVVSWNALSSRYLEH 24
L+ +Y++C + A +VF ++ ++VVSW A+ +H
Sbjct: 198 LITMYSKCGEISVACEVFHKMTERNVVSWTAIIQANAQH 236



Score = 101 bits (251), Expect = 2e-20
Identities = 54/163 (33%), Positives = 91/163 (55%), Gaps = 4/163 (2%)
Frame = -1

Query: 500 IHIEVTKEGLERDPLVGSALVGIYARSGALIDALKIFDKLCSRNVVSWTALISGYADHCF 321
+H E K GLE D +V ++L+G+Y++ G + +A +FDK+ +R+ V+W A+++GY H
Sbjct: 518 VHAEAVKLGLESDTVVATSLIGMYSKCGQVAEARTVFDKMSNRDTVAWNAMLAGYGQHGD 577

Query: 320 GAEALNCLKEMQADGVAPNDVTFVCGLKACGQIGALDRGRELHSMIAIEGFE---RDTFV 150
G EA++ K M + V+PN++T + AC + G + GRE+ M+ E F+ R
Sbjct: 578 GLEAVDLFKRMLKERVSPNEITLTAVISACSRAGLVQEGREIFRMMQ-EDFKMTPRKQHY 636

Query: 149 GNTLVDVYARCVMLLEARDVFDELQVQ-DVVSWNALSSRYLEH 24
G +VD+ R L EA + + + D+ W+AL H
Sbjct: 637 G-CMVDLLGRAGRLQEAEEFIQSMPCEPDISVWHALLGACKSH 678



Score = 55.1 bits (131), Expect = 2e-06
Identities = 25/94 (26%), Positives = 53/94 (56%)
Frame = -1

Query: 314 EALNCLKEMQADGVAPNDVTFVCGLKACGQIGALDRGRELHSMIAIEGFERDTFVGNTLV 135
EA+ L ++ G+ N T+ C ++ C + + G+ +H + G E D ++GN+L+
Sbjct: 39 EAIQLLGIIKQRGLLVNSNTYGCVIEHCAKARRFEDGKMVHKQLDELGVEIDIYLGNSLI 98

Query: 134 DVYARCVMLLEARDVFDELQVQDVVSWNALSSRY 33
+ Y++ + A VF + ++DVV+W+++ + Y
Sbjct: 99 NFYSKFEDVASAEQVFRRMTLRDVVTWSSMIAAY 132