BP918089
Clone id YMU001_000109_E01
Library
Length 517
Definition Adiantum capillus-veneris mRNA. clone: YMU001_000109_E01.
Accession
Tissue type prothallium
Developmental stage -
Contig ID -
Sequence
AATTCGCGGCCGCGAATCTGGTATCTTCACGACTGCCATTCTTCTTTTGCAGTGCTTCCA
CTCTTTCCATCCATTCCCATTTCATCAGCTAGTCCTTGTACCACAGCCAGCATGGTCTCT
GTCATGGCCGGTACTAACATCTTTATCAGTCGATTGGGCTGGTATCCTCTGAAGACTCTT
GCTTCGGAACTTTCTGGCTGCTCTAGCAGCTTCTTAACTAAATCCTCCGTGATTTTAGCT
GCTAGTTCCCTCTGCTCTTGCCACTCATCTACCACCTTCTCTTTACCTTTGGCCTTCCAA
ACTTCTCTTTGTTGAGCCCACTTGCTGCTGTTAGAATTGACTGGTACTTCTGAAATGTCT
GGGATTTCTTCAATGACTACTCCCTTGCTCCTGGTAACTACCCTGACTGGGACTAGCTCT
GGTGCCTTAGCCTCAGTAGTAGTCGTTACAGGTGCATCTGGACATTGGGCTGCCAAATGA
CAATACTTCCCACAAGTATAGCGATTCATGCTCCTGT
■■Homology search results ■■ -
sp_hit_id Q9HWD2
Definition sp|Q9HWD2|EFG1_PSEAE Elongation factor G 1 OS=Pseudomonas aeruginosa
Align length 52
Score (bit) 34.7
E-value 0.25
Report
BLASTX 2.2.19 [Nov-02-2008]


Reference: Altschul, Stephen F., Thomas L. Madden, Alejandro A. Schaffer,
Jinghui Zhang, Zheng Zhang, Webb Miller, and David J. Lipman (1997),
"Gapped BLAST and PSI-BLAST: a new generation of protein database search
programs", Nucleic Acids Res. 25:3389-3402.

Query= BP918089|Adiantum capillus-veneris mRNA, clone:
YMU001_000109_E01.
(500 letters)

Database: uniprot_sprot.fasta
412,525 sequences; 148,809,765 total letters

Searching..................................................done



Score E
Sequences producing significant alignments: (bits) Value

sp|Q9HWD2|EFG1_PSEAE Elongation factor G 1 OS=Pseudomonas aerugi... 35 0.25
sp|Q39KH0|EFG1_BURS3 Elongation factor G 1 OS=Burkholderia sp. (... 35 0.25
sp|Q3ILP5|EFG1_PSEHT Elongation factor G 1 OS=Pseudoalteromonas ... 34 0.33
sp|Q15643|TRIPB_HUMAN Thyroid receptor-interacting protein 11 OS... 34 0.43
sp|Q88QN8|EFG1_PSEPK Elongation factor G 1 OS=Pseudomonas putida... 33 0.57
sp|A0AUT1|TCHP_XENLA Trichoplein keratin filament-binding protei... 33 0.74
sp|Q21M89|EFG1_SACD2 Elongation factor G 1 OS=Saccharophagus deg... 33 0.96
sp|A4G9U1|EFG_HERAR Elongation factor G OS=Herminiimonas arsenic... 32 1.6
sp|A4SEF9|SECA_PROVI Protein translocase subunit secA OS=Prosthe... 32 2.1
sp|P81922|OR47B_DROME Odorant receptor 47b OS=Drosophila melanog... 32 2.1
sp|Q80TM9|NISCH_MOUSE Nischarin OS=Mus musculus GN=Nisch PE=1 SV=2 32 2.1
sp|Q9NZM3|ITSN2_HUMAN Intersectin-2 OS=Homo sapiens GN=ITSN2 PE=... 28 2.2
sp|Q9Z0R6|ITSN2_MOUSE Intersectin-2 OS=Mus musculus GN=Itsn2 PE=... 28 2.8
sp|Q7ZW86|SDC10_DANRE Peptidyl-prolyl cis-trans isomerase SDCCAG... 31 2.8
sp|P53261|PESC_YEAST Pescadillo homolog OS=Saccharomyces cerevis... 31 2.8
sp|A6T3K7|EFG_JANMA Elongation factor G OS=Janthinobacterium sp.... 31 2.8
sp|Q605A9|EFG2_METCA Elongation factor G 2 OS=Methylococcus caps... 31 2.8
sp|Q7SA04|SEM1_NEUCR Putative 26S proteasome complex subunit sem... 31 3.7
sp|Q23541|JAD1_CAEEL Histone demethylase rbr-2 OS=Caenorhabditis... 31 3.7
sp|Q9KUI6|MUTS_VIBCH DNA mismatch repair protein mutS OS=Vibrio ... 30 4.8
sp|A5F9C4|MUTS_VIBC3 DNA mismatch repair protein mutS OS=Vibrio ... 30 4.8
sp|Q5QV36|HSLU_IDILO ATP-dependent hsl protease ATP-binding subu... 30 4.8
sp|Q0ID58|EFG_SYNS3 Elongation factor G OS=Synechococcus sp. (st... 30 4.8
sp|Q8C8N3|VWC2_MOUSE Brorin OS=Mus musculus GN=Vwc2 PE=1 SV=1 30 6.3
sp|Q28298|RRBP1_CANFA Ribosome-binding protein 1 OS=Canis famili... 30 6.3
sp|Q58605|METK_METJA S-adenosylmethionine synthetase OS=Methanoc... 30 6.3
sp|Q9GYZ0|KIF15_STRPU Kinesin-like protein KIF15 OS=Strongylocen... 30 6.3
sp|Q9RVG1|HBD_DEIRA Probable 3-hydroxybutyryl-CoA dehydrogenase ... 30 6.3
sp|Q9HN62|SYY_HALSA Tyrosyl-tRNA synthetase OS=Halobacterium sal... 30 8.2
sp|P69411|RCSF_ECOLI Protein rcsF OS=Escherichia coli (strain K1... 30 8.2

>sp|Q9HWD2|EFG1_PSEAE Elongation factor G 1 OS=Pseudomonas
aeruginosa GN=fusA PE=3 SV=1
Length = 706

Score = 34.7 bits (78), Expect = 0.25
Identities = 19/52 (36%), Positives = 30/52 (57%), Gaps = 1/52 (1%)
Frame = -3

Query: 258 VVDEWQEQR-ELAAKITEDLVKKLLEQPESSEARVFRGYQPNRLIKMLVPAM 106
+ +EW+ E AA+ E+L+ K LE+ E SEA + G + L +VPA+
Sbjct: 214 LAEEWRSSMVEAAAEANEELMNKYLEEGELSEAEIKEGLRLRTLACEIVPAV 265


>sp|Q39KH0|EFG1_BURS3 Elongation factor G 1 OS=Burkholderia sp.
(strain 383) GN=fusA1 PE=3 SV=1
Length = 700

Score = 34.7 bits (78), Expect = 0.25
Identities = 19/53 (35%), Positives = 30/53 (56%), Gaps = 1/53 (1%)
Frame = -3

Query: 252 DEWQEQR-ELAAKITEDLVKKLLEQPESSEARVFRGYQPNRLIKMLVPAMTET 97
+EW+E+ E AA+ EDL+ K LE E SEA + +G + + + P + T
Sbjct: 216 NEWREKMVEAAAESNEDLMNKYLEAGELSEAEIVKGLRDRTIACEIQPMLCGT 268


>sp|Q3ILP5|EFG1_PSEHT Elongation factor G 1 OS=Pseudoalteromonas
haloplanktis (strain TAC 125) GN=fusA1 PE=3 SV=1
Length = 704

Score = 34.3 bits (77), Expect = 0.33
Identities = 19/52 (36%), Positives = 29/52 (55%), Gaps = 1/52 (1%)
Frame = -3

Query: 264 EKVVDEWQEQR-ELAAKITEDLVKKLLEQPESSEARVFRGYQPNRLIKMLVP 112
+++ DEW+ E AA+ TE+L+ K LE E SEA + + L +VP
Sbjct: 212 QELADEWRSHLVESAAEATEELMDKYLEGEELSEAEIKEALRQRTLANDIVP 263


>sp|Q15643|TRIPB_HUMAN Thyroid receptor-interacting protein 11 OS=Homo
sapiens GN=TRIP11 PE=1 SV=2
Length = 1979

Score = 33.9 bits (76), Expect = 0.43
Identities = 23/81 (28%), Positives = 44/81 (54%)
Frame = -3

Query: 369 KGVVIEEIPDISEVPVNSNSSKWAQQREVWKAKGKEKVVDEWQEQRELAAKITEDLVKKL 190
K + ++E D + ++S +S+ +Q +V KE+ ++E + Q EL ++ +D+ KKL
Sbjct: 1715 KVISLQECLDEANAALDS-ASRLTEQLDV-----KEEQIEELKRQNELRQEMLDDVQKKL 1768

Query: 189 LEQPESSEARVFRGYQPNRLI 127
+ SSE +V + N I
Sbjct: 1769 MSLANSSEGKVDKVLMRNLFI 1789


>sp|Q88QN8|EFG1_PSEPK Elongation factor G 1 OS=Pseudomonas putida
(strain KT2440) GN=fusA PE=3 SV=1
Length = 715

Score = 33.5 bits (75), Expect = 0.57
Identities = 18/53 (33%), Positives = 30/53 (56%), Gaps = 1/53 (1%)
Frame = -3

Query: 261 KVVDEWQEQR-ELAAKITEDLVKKLLEQPESSEARVFRGYQPNRLIKMLVPAM 106
++ +EW+ E AA+ TE+L+ K LE+ E S + G + L +VPA+
Sbjct: 213 ELANEWRNNMVEAAAEATEELMNKYLEEGELSVEEIKAGLRARTLASEIVPAV 265


>sp|A0AUT1|TCHP_XENLA Trichoplein keratin filament-binding protein
OS=Xenopus laevis GN=tchp PE=2 SV=1
Length = 499

Score = 33.1 bits (74), Expect = 0.74
Identities = 19/44 (43%), Positives = 27/44 (61%)
Frame = -3

Query: 273 KGKEKVVDEWQEQRELAAKITEDLVKKLLEQPESSEARVFRGYQ 142
KGKE +V + +E++E K+ EDL LL+Q +E RGYQ
Sbjct: 448 KGKEAIVQQEEEEKEF--KLAEDLENDLLQQ--EAEIMTQRGYQ 487


>sp|Q21M89|EFG1_SACD2 Elongation factor G 1 OS=Saccharophagus
degradans (strain 2-40 / ATCC 43961 / DSM 17024)
GN=fusA1 PE=3 SV=1
Length = 701

Score = 32.7 bits (73), Expect = 0.96
Identities = 19/57 (33%), Positives = 31/57 (54%), Gaps = 4/57 (7%)
Frame = -3

Query: 264 EKVVDEWQEQRELA----AKITEDLVKKLLEQPESSEARVFRGYQPNRLIKMLVPAM 106
E +++E +E RE A A+ +DL++K LE E SE + G + L +VP +
Sbjct: 209 EDLLEECEEMREYAVEAAAEANDDLMEKYLETGELSEDEIKAGLRARTLANEIVPVL 265


>sp|A4G9U1|EFG_HERAR Elongation factor G OS=Herminiimonas
arsenicoxydans GN=fusA PE=3 SV=1
Length = 702

Score = 32.0 bits (71), Expect = 1.6
Identities = 17/52 (32%), Positives = 29/52 (55%), Gaps = 1/52 (1%)
Frame = -3

Query: 249 EWQEQR-ELAAKITEDLVKKLLEQPESSEARVFRGYQPNRLIKMLVPAMTET 97
+W+E E AA+ +E+L+ K LE+ + SEA + + + +VP M T
Sbjct: 217 KWRENMVEAAAEASEELMNKYLEEGDLSEAEIKAALRTRTIANEIVPMMCGT 268


>sp|A4SEF9|SECA_PROVI Protein translocase subunit secA
OS=Prosthecochloris vibrioformis (strain DSM 265)
(strain DSM 265) GN=secA PE=3 SV=1
Length = 1020

Score = 31.6 bits (70), Expect = 2.1
Identities = 37/122 (30%), Positives = 57/122 (46%), Gaps = 8/122 (6%)
Frame = -3

Query: 384 VVTRSKGVVIEEI--PDISEVPVNSNSSKWAQQREVWKAKGKEKVVDEWQEQRELAAKIT 211
+V V+I+E P I PV ++ + Q+ + W E++V + Q++LAA
Sbjct: 263 IVDEVDSVLIDEARTPLIISGPVPNSDNSQFQEIKPWI----EQIV---RAQQQLAASYL 315

Query: 210 EDLVKKLLEQPESSEA-----RVFRGYQPN-RLIKMLVPAMTETMLAVVQGLADEMGMDG 49
+ K L E P+S EA RV RG N R IK+L + M ++Q +E D
Sbjct: 316 TEAEKALKESPQSPEAGLALLRVKRGQPKNTRFIKIL---SQQGMAKLIQVTENEYLRDN 372

Query: 48 KS 43
S
Sbjct: 373 SS 374


>sp|P81922|OR47B_DROME Odorant receptor 47b OS=Drosophila
melanogaster GN=Or47b PE=2 SV=2
Length = 412

Score = 31.6 bits (70), Expect = 2.1
Identities = 20/45 (44%), Positives = 23/45 (51%), Gaps = 8/45 (17%)
Frame = +3

Query: 39 FHSFHPFPFHQLVLVPQPAWSL-SWPVLTS-------LSVDWAGI 149
FHS +PF +H+L L P W L W LTS L VD GI
Sbjct: 184 FHSVYPFQWHRLDLHPYTFWFLYIWQSLTSQHNLMSILMVDMVGI 228


tr_hit_id B8GV61
Definition tr|B8GV61|B8GV61_9GAMM Translation elongation factor 2 (EF-2/EF-G) OS=Thioalkalivibrio sp. HL-EbGR7
Align length 57
Score (bit) 37.4
E-value 0.39
Report
BLASTX 2.2.19 [Nov-02-2008]


Reference: Altschul, Stephen F., Thomas L. Madden, Alejandro A. Schaffer,
Jinghui Zhang, Zheng Zhang, Webb Miller, and David J. Lipman (1997),
"Gapped BLAST and PSI-BLAST: a new generation of protein database search
programs", Nucleic Acids Res. 25:3389-3402.

Query= BP918089|Adiantum capillus-veneris mRNA, clone:
YMU001_000109_E01.
(500 letters)

Database: uniprot_trembl.fasta
7,341,751 sequences; 2,391,615,440 total letters

Searching..................................................done



Score E
Sequences producing significant alignments: (bits) Value

tr|B8GV61|B8GV61_9GAMM Translation elongation factor 2 (EF-2/EF-... 37 0.39
tr|Q7X204|Q7X204_PSEHA Elongation factor G OS=Pseudoalteromonas ... 36 0.88
tr|Q28YN3|Q28YN3_DROPS GA20876 OS=Drosophila pseudoobscura pseud... 36 1.1
tr|B4H8E7|B4H8E7_DROPE GL20038 OS=Drosophila persimilis GN=GL200... 36 1.1
tr|Q23YU2|Q23YU2_TETTH Putative uncharacterized protein OS=Tetra... 35 1.5
tr|A8NG58|A8NG58_COPC7 Putative uncharacterized protein OS=Copri... 35 1.5
tr|A8H4Z0|A8H4Z0_SHEPA SMC domain protein OS=Shewanella pealeana... 35 2.0
tr|A4S7R8|A4S7R8_OSTLU Predicted protein OS=Ostreococcus lucimar... 35 2.0
tr|A8XWS4|A8XWS4_CAEBR Putative uncharacterized protein (Fragmen... 35 2.0
tr|Q0BJ49|Q0BJ49_BURCM Translation elongation factor 2 (EF-2/EF-... 35 2.6
tr|Q02T83|Q02T83_PSEAB Elongation factor G OS=Pseudomonas aerugi... 35 2.6
tr|A6UZI5|A6UZI5_PSEA7 Translation elongation factor G OS=Pseudo... 35 2.6
tr|B7V641|B7V641_PSEAE Elongation factor G OS=Pseudomonas aerugi... 35 2.6
tr|A3KZD9|A3KZD9_PSEAE Elongation factor G (Fragment) OS=Pseudom... 35 2.6
tr|B7Q7A0|B7Q7A0_IXOSC Amyloid beta A4 protein (APP)-binding pro... 35 2.6
tr|A3ZKX0|A3ZKX0_9PLAN Putative uncharacterized protein OS=Blast... 34 3.3
tr|B6PUC7|B6PUC7_BRAFL Putative uncharacterized protein OS=Branc... 34 3.3
tr|B6NEN4|B6NEN4_BRAFL Putative uncharacterized protein OS=Branc... 34 3.3
tr|B6KSA6|B6KSA6_TOXGO Ribosomal protein S12, putative OS=Toxopl... 34 3.3
tr|Q871K8|Q871K8_NEUCR Putative uncharacterized protein 20H10.10... 34 3.3
tr|Q0V3K3|Q0V3K3_PHANO Putative uncharacterized protein OS=Phaeo... 34 3.3
tr|B8M9J3|B8M9J3_9EURO Isopenicillin N-CoA epimerase, putative O... 34 3.3
tr|B2J5Y6|B2J5Y6_NOSP7 ATP-dependent endonuclease of the OLD fam... 34 4.4
tr|Q9SMS0|Q9SMS0_ARATH Putative uncharacterized protein AT4g0935... 34 4.4
tr|Q6MZL5|Q6MZL5_HUMAN Putative uncharacterized protein DKFZp686... 34 4.4
tr|B2RUT2|B2RUT2_HUMAN Thyroid hormone receptor interactor 11 OS... 34 4.4
tr|Q2G795|Q2G795_NOVAD Glucose sorbosone dehydrogenase OS=Novosp... 33 5.7
tr|A5VXP4|A5VXP4_PSEP1 Translation elongation factor 2 (EF-2/EF-... 33 5.7
tr|A8QYU7|A8QYU7_9GAMM Putative uncharacterized protein OS=Fluor... 33 5.7
tr|O24517|O24517_HELAN Unconventional myosin OS=Helianthus annuu... 33 5.7

>tr|B8GV61|B8GV61_9GAMM Translation elongation factor 2 (EF-2/EF-G)
OS=Thioalkalivibrio sp. HL-EbGR7 GN=Tgr7_2327 PE=4 SV=1
Length = 697

Score = 37.4 bits (85), Expect = 0.39
Identities = 19/57 (33%), Positives = 35/57 (61%), Gaps = 1/57 (1%)
Frame = -3

Query: 264 EKVVDEWQEQR-ELAAKITEDLVKKLLEQPESSEARVFRGYQPNRLIKMLVPAMTET 97
+ + +EW+E+ E AA+ +E+L+ K LE+ E SEA + +G + + +VP + T
Sbjct: 212 QALAEEWREKMVEAAAESSEELMNKYLEEGELSEAEIKQGLRQRTIALEIVPMLCGT 268


>tr|Q7X204|Q7X204_PSEHA Elongation factor G OS=Pseudoalteromonas
haloplanktis GN=fus PE=4 SV=1
Length = 704

Score = 36.2 bits (82), Expect = 0.88
Identities = 20/52 (38%), Positives = 30/52 (57%), Gaps = 1/52 (1%)
Frame = -3

Query: 264 EKVVDEWQEQR-ELAAKITEDLVKKLLEQPESSEARVFRGYQPNRLIKMLVP 112
+++ DEW+ Q E AA+ TE+L+ K LE E SEA + + L +VP
Sbjct: 212 QELADEWRSQLVESAAEATEELMDKYLEGEELSEAEIKEALRQRTLANDIVP 263


>tr|Q28YN3|Q28YN3_DROPS GA20876 OS=Drosophila pseudoobscura
pseudoobscura GN=GA20876 PE=3 SV=2
Length = 1918

Score = 35.8 bits (81), Expect = 1.1
Identities = 24/72 (33%), Positives = 35/72 (48%)
Frame = -3

Query: 381 VTRSKGVVIEEIPDISEVPVNSNSSKWAQQREVWKAKGKEKVVDEWQEQRELAAKITEDL 202
+T + + I+E PD+ V NS ++ A+ K K K QE+ E AK ++
Sbjct: 1574 ITSMRSMSIDETPDLDRVNSNSPPNRQARVNPFLKDMPKAKT----QEKVEPQAKTLQEA 1629

Query: 201 VKKLLEQPESSE 166
LEQPES E
Sbjct: 1630 FTHPLEQPESKE 1641


>tr|B4H8E7|B4H8E7_DROPE GL20038 OS=Drosophila persimilis GN=GL20038
PE=4 SV=1
Length = 1421

Score = 35.8 bits (81), Expect = 1.1
Identities = 24/72 (33%), Positives = 35/72 (48%)
Frame = -3

Query: 381 VTRSKGVVIEEIPDISEVPVNSNSSKWAQQREVWKAKGKEKVVDEWQEQRELAAKITEDL 202
+T + + I+E PD+ V NS ++ A+ K K K QE+ E AK ++
Sbjct: 1076 ITSMRSMSIDETPDLDRVNSNSPPNRQARVNPFLKDMPKAKT----QEKVEPQAKTLQEA 1131

Query: 201 VKKLLEQPESSE 166
LEQPES E
Sbjct: 1132 FTHPLEQPESKE 1143


>tr|Q23YU2|Q23YU2_TETTH Putative uncharacterized protein
OS=Tetrahymena thermophila SB210 GN=TTHERM_00859180 PE=4
SV=1
Length = 2381

Score = 35.4 bits (80), Expect = 1.5
Identities = 18/54 (33%), Positives = 35/54 (64%)
Frame = -3

Query: 318 SNSSKWAQQREVWKAKGKEKVVDEWQEQRELAAKITEDLVKKLLEQPESSEARV 157
SNSS ++ ++ K K +++D ++Q+E ++K+T D V +LLE+ ++ RV
Sbjct: 389 SNSSSNEEKMDIEKDKDTLEIIDYEKKQKEFSSKVTIDEVDQLLERMKNLNDRV 442


>tr|A8NG58|A8NG58_COPC7 Putative uncharacterized protein
OS=Coprinopsis cinerea (strain Okayama-7 / 130 / FGSC
9003) GN=CC1G_05183 PE=4 SV=1
Length = 446

Score = 35.4 bits (80), Expect = 1.5
Identities = 17/54 (31%), Positives = 27/54 (50%)
Frame = -3

Query: 447 CPDAPVTTTTEAKAPELVPVRVVTRSKGVVIEEIPDISEVPVNSNSSKWAQQRE 286
CP++ V T P L P + T+S + +EE+P S P+ +S + A E
Sbjct: 18 CPESQVVVTEAPITPPLSPKSIATKSGAMPVEEMPICSSKPIQIHSEQEAMDVE 71


>tr|A8H4Z0|A8H4Z0_SHEPA SMC domain protein OS=Shewanella pealeana
(strain ATCC 700345 / ANG-SQ1) GN=Spea_2307 PE=4 SV=1
Length = 676

Score = 35.0 bits (79), Expect = 2.0
Identities = 24/75 (32%), Positives = 38/75 (50%)
Frame = -3

Query: 426 TTTEAKAPELVPVRVVTRSKGVVIEEIPDISEVPVNSNSSKWAQQREVWKAKGKEKVVDE 247
T E A EL + R+K +I + + +E+ ++S WAQ RE KAK E +
Sbjct: 224 TAAEHAAVELTNKASLCRAKIELIAKDIEKTELDLSSRGGAWAQSREQEKAKQFELDAER 283

Query: 246 WQEQRELAAKITEDL 202
+ ++ L A+I DL
Sbjct: 284 KELEKTLRAEIEGDL 298


>tr|A4S7R8|A4S7R8_OSTLU Predicted protein OS=Ostreococcus
lucimarinus (strain CCE9901) GN=OSTLU_42969 PE=4 SV=1
Length = 274

Score = 35.0 bits (79), Expect = 2.0
Identities = 22/63 (34%), Positives = 37/63 (58%), Gaps = 2/63 (3%)
Frame = -3

Query: 306 KWAQQREVWKAKGKEKVVDEWQEQRELAAKITEDLVKKLLEQPESSEARV--FRGYQPNR 133
+W +++ + KG+EK V E +E+ ELA + E KK +Q E EARV +R + ++
Sbjct: 173 EWRRRKMALRIKGEEKRVTE-EEKAELAQRRKEHKEKKEWDQDERREARVGGWRDFMKDK 231

Query: 132 LIK 124
+K
Sbjct: 232 KVK 234


>tr|A8XWS4|A8XWS4_CAEBR Putative uncharacterized protein (Fragment)
OS=Caenorhabditis briggsae GN=CBG19947 PE=4 SV=1
Length = 501

Score = 35.0 bits (79), Expect = 2.0
Identities = 20/84 (23%), Positives = 43/84 (51%), Gaps = 4/84 (4%)
Frame = -3

Query: 423 TTEAKAPELVPVRVVTRSKGVVIEEIPD----ISEVPVNSNSSKWAQQREVWKAKGKEKV 256
T K+PE P +V + + ++E++P+ + E P K + ++ + K + KV
Sbjct: 378 TQREKSPERKPEPIVKQEEEKILEKVPEEPKKVEEEPKKEEPVKVEESPKIGEKKEEVKV 437

Query: 255 VDEWQEQRELAAKITEDLVKKLLE 184
V+E + + +A E+ +KK ++
Sbjct: 438 VEEKKPEPPVAVVPVEEKLKKRIQ 461


>tr|Q0BJ49|Q0BJ49_BURCM Translation elongation factor 2 (EF-2/EF-G)
OS=Burkholderia ambifaria (strain ATCC BAA-244 / AMMD)
GN=Bamb_0264 PE=4 SV=1
Length = 700

Score = 34.7 bits (78), Expect = 2.6
Identities = 19/53 (35%), Positives = 30/53 (56%), Gaps = 1/53 (1%)
Frame = -3

Query: 252 DEWQEQR-ELAAKITEDLVKKLLEQPESSEARVFRGYQPNRLIKMLVPAMTET 97
+EW+E+ E AA+ EDL+ K LE E SEA + +G + + + P + T
Sbjct: 216 NEWREKMVEAAAESNEDLMNKYLEAGELSEAEIVKGLRDRTIACEIQPMLCGT 268