BP918123
Clone id YMU001_000109_G12
Library
Length 513
Definition Adiantum capillus-veneris mRNA. clone: YMU001_000109_G12.
Accession
Tissue type prothallium
Developmental stage -
Contig ID
Sequence
CTGAAAGATCCAGTGGCTCCTCGGGAATGGCGCTGGCGTTGGCTCCATTCTTTAGGCTTT
GACATGTCAGCAGTTTGTTACATTCTACATCTAGTCTCATAGATCCATTAGAGTTCAAAG
TGTTACCCATAAGATCTCATAGCCTATATATAATCATGGAGATTTCCTATCAATAGTTAA
GTCTACCATTAGCATAGTCAACATACTTCCGACCTTTCTTTGTCTCAAATATGCATGTCA
TATGCTGTGCTCTACGTACCACATGTGGAATAGTAGCATCCCCACCCATAAATATCCTTT
CCATTTAAATTGTCTCTTGTGTATTAGACCGCCCTCTTTTTATCCATGCCTACAATCTAT
AGAATCAATGCTACCCTCAGTGTCTCTTGTGTATTAGAACGCCCTCTTTTTATCCATGCC
TACAATCAATGCTACCCTCAGTGCTCTCTACTCTTGCTAATGCGCCATGCATTCGTTATG
GTTAGCTACCCCACTTTTTCTACTCAATGATTT
■■Homology search results ■■ -
sp_hit_id Q8BU91
Definition sp|Q8BU91|S26A9_MOUSE Solute carrier family 26 member 9 OS=Mus musculus
Align length 30
Score (bit) 27.3
E-value 0.74
Report
BLASTX 2.2.19 [Nov-02-2008]


Reference: Altschul, Stephen F., Thomas L. Madden, Alejandro A. Schaffer,
Jinghui Zhang, Zheng Zhang, Webb Miller, and David J. Lipman (1997),
"Gapped BLAST and PSI-BLAST: a new generation of protein database search
programs", Nucleic Acids Res. 25:3389-3402.

Query= BP918123|Adiantum capillus-veneris mRNA, clone:
YMU001_000109_G12.
(513 letters)

Database: uniprot_sprot.fasta
412,525 sequences; 148,809,765 total letters

Searching..................................................done



Score E
Sequences producing significant alignments: (bits) Value

sp|Q8BU91|S26A9_MOUSE Solute carrier family 26 member 9 OS=Mus m... 27 0.74
sp|Q5RCD3|UBP4_PONAB Ubiquitin carboxyl-terminal hydrolase 4 OS=... 32 1.3
sp|Q13107|UBP4_HUMAN Ubiquitin carboxyl-terminal hydrolase 4 OS=... 32 1.3
sp|P62932|FBX40_MOUSE F-box only protein 40 OS=Mus musculus GN=F... 32 2.2
sp|Q7LBE3|S26A9_HUMAN Solute carrier family 26 member 9 OS=Homo ... 27 2.6
sp|Q9QZK9|DNS2B_RAT Deoxyribonuclease-2-beta OS=Rattus norvegicu... 31 3.8
sp|P35123|UBP4_MOUSE Ubiquitin carboxyl-terminal hydrolase 4 OS=... 30 5.0

>sp|Q8BU91|S26A9_MOUSE Solute carrier family 26 member 9 OS=Mus
musculus GN=Slc26a9 PE=2 SV=1
Length = 790

Score = 27.3 bits (59), Expect(2) = 0.74
Identities = 13/30 (43%), Positives = 17/30 (56%)
Frame = +3

Query: 183 LPLA*STYFRPFFVSNMHVICCALRTTCGI 272
+ L S +F FF +HVICCAL T +
Sbjct: 370 IALGCSNFFGSFF--KIHVICCALSVTLAV 397



Score = 24.6 bits (52), Expect(2) = 0.74
Identities = 9/28 (32%), Positives = 17/28 (60%)
Frame = +1

Query: 10 PVAPREWRWRWLHSLGFDMSAVCYILHL 93
PVAP +W+ + F ++ V Y+++L
Sbjct: 322 PVAPMVSQWKGMVGTAFSLAIVGYVINL 349


>sp|Q5RCD3|UBP4_PONAB Ubiquitin carboxyl-terminal hydrolase 4
OS=Pongo abelii GN=USP4 PE=2 SV=1
Length = 963

Score = 32.3 bits (72), Expect = 1.3
Identities = 19/59 (32%), Positives = 28/59 (47%)
Frame = +2

Query: 320 CIRPPSFYPCLQSIESMLPSVSLVY*NALFLSMPTINATLSALYSC*CAMHSLWLATPL 496
C+ P ++ +S S S S +Y L LS+P TL +LY C S ++ PL
Sbjct: 577 CVTLPVYFRERKSRPSSTSSASALYGQPLLLSVPKHKLTLESLYQAVCDRISRYVKQPL 635


>sp|Q13107|UBP4_HUMAN Ubiquitin carboxyl-terminal hydrolase 4
OS=Homo sapiens GN=USP4 PE=1 SV=3
Length = 963

Score = 32.3 bits (72), Expect = 1.3
Identities = 19/59 (32%), Positives = 28/59 (47%)
Frame = +2

Query: 320 CIRPPSFYPCLQSIESMLPSVSLVY*NALFLSMPTINATLSALYSC*CAMHSLWLATPL 496
C+ P ++ +S S S S +Y L LS+P TL +LY C S ++ PL
Sbjct: 577 CVTLPVYFRERKSRPSSTSSASALYGQPLLLSVPKHKLTLESLYQAVCDRISRYVKQPL 635


>sp|P62932|FBX40_MOUSE F-box only protein 40 OS=Mus musculus
GN=Fbxo40 PE=2 SV=1
Length = 710

Score = 31.6 bits (70), Expect = 2.2
Identities = 21/55 (38%), Positives = 27/55 (49%), Gaps = 1/55 (1%)
Frame = +2

Query: 197 VNILPTFLCLKYACHMLC-STYHMWNSSIPTHKYPFHLNCLLCIRPPSFYPCLQS 358
V + P+ CL +CH+LC +T+HM S T LLC P PCL S
Sbjct: 25 VPVEPSVSCLVISCHLLCGATFHMCKESEHT---------LLC--PLEQVPCLNS 68


>sp|Q7LBE3|S26A9_HUMAN Solute carrier family 26 member 9 OS=Homo
sapiens GN=SLC26A9 PE=2 SV=1
Length = 791

Score = 27.3 bits (59), Expect(2) = 2.6
Identities = 13/30 (43%), Positives = 17/30 (56%)
Frame = +3

Query: 183 LPLA*STYFRPFFVSNMHVICCALRTTCGI 272
+ L S +F FF +HVICCAL T +
Sbjct: 370 IALGCSNFFGSFF--KIHVICCALSVTLAV 397



Score = 22.7 bits (47), Expect(2) = 2.6
Identities = 8/28 (28%), Positives = 17/28 (60%)
Frame = +1

Query: 10 PVAPREWRWRWLHSLGFDMSAVCYILHL 93
PV+P +W+ + F ++ V Y+++L
Sbjct: 322 PVSPVVSQWKDMIGTAFSLAIVSYVINL 349


>sp|Q9QZK9|DNS2B_RAT Deoxyribonuclease-2-beta OS=Rattus norvegicus
GN=Dnase2b PE=1 SV=1
Length = 356

Score = 30.8 bits (68), Expect = 3.8
Identities = 16/59 (27%), Positives = 29/59 (49%), Gaps = 1/59 (1%)
Frame = +2

Query: 161 DFLSIVKSTISIVNILPTFLCLKYACHMLCSTYHMWNSSIPTH-KYPFHLNCLLCIRPP 334
+FL KST +I ++ K H+L ++ N +P++ P+H+ + IR P
Sbjct: 231 NFLHFAKSTFYTDDIFAAWIAQKLKVHLLVESWQRKNHELPSNCSLPYHVYNIKAIRGP 289


>sp|P35123|UBP4_MOUSE Ubiquitin carboxyl-terminal hydrolase 4 OS=Mus
musculus GN=Usp4 PE=2 SV=2
Length = 962

Score = 30.4 bits (67), Expect = 5.0
Identities = 18/59 (30%), Positives = 29/59 (49%)
Frame = +2

Query: 320 CIRPPSFYPCLQSIESMLPSVSLVY*NALFLSMPTINATLSALYSC*CAMHSLWLATPL 496
CI P ++ +S S S +++Y L +S+P TL +LY C S ++ PL
Sbjct: 577 CITLPVYFREKKSRPSSASSGAVLYGQPLLVSVPKHKLTLESLYQAVCDRISRYIKQPL 635


tr_hit_id Q9XMG4
Definition tr|Q9XMG4|Q9XMG4_9CEST NADH-ubiquinone oxidoreductase chain 1 (Fragment) OS=Echinococcus vogeli
Align length 66
Score (bit) 36.2
E-value 0.96
Report
BLASTX 2.2.19 [Nov-02-2008]


Reference: Altschul, Stephen F., Thomas L. Madden, Alejandro A. Schaffer,
Jinghui Zhang, Zheng Zhang, Webb Miller, and David J. Lipman (1997),
"Gapped BLAST and PSI-BLAST: a new generation of protein database search
programs", Nucleic Acids Res. 25:3389-3402.

Query= BP918123|Adiantum capillus-veneris mRNA, clone:
YMU001_000109_G12.
(513 letters)

Database: uniprot_trembl.fasta
7,341,751 sequences; 2,391,615,440 total letters

Searching..................................................done



Score E
Sequences producing significant alignments: (bits) Value

tr|Q9XMG4|Q9XMG4_9CEST NADH-ubiquinone oxidoreductase chain 1 (F... 36 0.96
tr|A4PBD6|A4PBD6_9CEST NADH-ubiquinone oxidoreductase chain 1 OS... 36 0.96
tr|Q9XMF7|Q9XMF7_9CEST NADH-ubiquinone oxidoreductase chain 1 (F... 34 3.7
tr|Q22M55|Q22M55_TETTH Putative uncharacterized protein OS=Tetra... 34 4.8
tr|Q53FJ3|Q53FJ3_HUMAN Ubiquitin carboxyl-terminal hydrolase (Fr... 33 8.1

>tr|Q9XMG4|Q9XMG4_9CEST NADH-ubiquinone oxidoreductase chain 1
(Fragment) OS=Echinococcus vogeli GN=ND1 PE=3 SV=1
Length = 157

Score = 36.2 bits (82), Expect = 0.96
Identities = 20/66 (30%), Positives = 31/66 (46%), Gaps = 8/66 (12%)
Frame = +2

Query: 149 YNHGDFLSIVKSTISIVNILPTFLCLKYACHMLCSTYHM--------WNSSIPTHKYPFH 304
YN+ FLS V+ S V+ F+C+ C + C +Y++ WN + Y
Sbjct: 82 YNNYSFLSSVRCAFSSVSFEACFMCVVIFCALCCCSYNLVDFYNSCWWNWLLFPLIYGLF 141

Query: 305 LNCLLC 322
L C+LC
Sbjct: 142 LICVLC 147


>tr|A4PBD6|A4PBD6_9CEST NADH-ubiquinone oxidoreductase chain 1
OS=Echinococcus vogeli GN=nad1 PE=3 SV=1
Length = 297

Score = 36.2 bits (82), Expect = 0.96
Identities = 20/66 (30%), Positives = 31/66 (46%), Gaps = 8/66 (12%)
Frame = +2

Query: 149 YNHGDFLSIVKSTISIVNILPTFLCLKYACHMLCSTYHM--------WNSSIPTHKYPFH 304
YN+ FLS V+ S V+ F+C+ C + C +Y++ WN + Y
Sbjct: 127 YNNYSFLSSVRCAFSSVSFEACFMCVVIFCALCCCSYNLVDFYNSCWWNWLLFPLIYGLF 186

Query: 305 LNCLLC 322
L C+LC
Sbjct: 187 LICVLC 192


>tr|Q9XMF7|Q9XMF7_9CEST NADH-ubiquinone oxidoreductase chain 1
(Fragment) OS=Echinococcus ortleppi GN=ND1 PE=3 SV=1
Length = 157

Score = 34.3 bits (77), Expect = 3.7
Identities = 19/66 (28%), Positives = 30/66 (45%), Gaps = 8/66 (12%)
Frame = +2

Query: 149 YNHGDFLSIVKSTISIVNILPTFLCLKYACHMLCSTYHM--------WNSSIPTHKYPFH 304
YN FLS V+ V+ F+C+ C + C +Y++ W+ + Y F
Sbjct: 82 YNSYSFLSSVRCAFGSVSFEACFMCVVIFCALCCCSYNLIDFYHSYWWSWLLFPLIYGFF 141

Query: 305 LNCLLC 322
L C+LC
Sbjct: 142 LVCVLC 147


>tr|Q22M55|Q22M55_TETTH Putative uncharacterized protein
OS=Tetrahymena thermophila SB210 GN=TTHERM_00037650 PE=4
SV=1
Length = 1906

Score = 33.9 bits (76), Expect = 4.8
Identities = 20/55 (36%), Positives = 25/55 (45%)
Frame = +3

Query: 228 NMHVICCALRTTCGIVASPPINILSI*IVSCVLDRPLFIHAYNL*NQCYPQCLLC 392
N + C A TTC SP I LS V+C + F+ N+ N C CL C
Sbjct: 177 NNCLTCQAQSTTCISCKSPQILNLSSQCVNCDQNNGYFVSPQNICNPCDASCLTC 231


>tr|Q53FJ3|Q53FJ3_HUMAN Ubiquitin carboxyl-terminal hydrolase
(Fragment) OS=Homo sapiens PE=2 SV=1
Length = 963

Score = 33.1 bits (74), Expect = 8.1
Identities = 19/59 (32%), Positives = 29/59 (49%)
Frame = +2

Query: 320 CIRPPSFYPCLQSIESMLPSVSLVY*NALFLSMPTINATLSALYSC*CAMHSLWLATPL 496
C+ P ++ +S S+ S S +Y L LS+P TL +LY C S ++ PL
Sbjct: 577 CVTLPVYFRERKSRPSITSSASALYGQPLLLSVPKHKLTLESLYQAVCDRISRYVKQPL 635