BP918157
Clone id YMU001_000110_C02
Library
Length 550
Definition Adiantum capillus-veneris mRNA. clone: YMU001_000110_C02.
Accession
Tissue type prothallium
Developmental stage -
Contig ID
Sequence
TGTTCCTGAAAAACGACCTACTGCCAGTCAATGTCTTTTGCATTCATGGCTCAATGTAGG
ACTTCACAATACACAGGCTCAGTTTTTGTCAAACCAGGGCCAGGTAGGCTCTGAAGTCCA
AAATGAGAGGTCTACTGTTGTAGGGACTAAAGACGCTATGGAGAAAGCCGAGGAAGCAAT
GGGGAATATTGTGTTGGCCAGTGGCCAAATGGATAAAGACAGGCTTTCTGGGAGAGCAAA
TCATGGAGGTACTTCTAGTTTTTGATAAAGAGCTCCTAATATGAGTCTGATTACTATTCG
TGGTCTCTTAAGGAGCATTTACAGTTGTTTATTTTCAATTGACATTTATTCACATCTCTC
ACTGATCTTCAATGATTCATTCACATTGCTTCTTGCCACGGCTCACCAAAGACATTTATA
TGATTTGAGAAAAACCTTGTTGGAGGAATTCGTACCCTCCAGAACGAGAAAGTTGCATGT
ATCTAACGTGTGTATCAAGACTTGGTCCTCATTGTGGACTGCTTTTGTGTACTACAATTC
AAGCCCATTG
■■Homology search results ■■ -
sp_hit_id Q91XS8
Definition sp|Q91XS8|ST17B_RAT Serine/threonine-protein kinase 17B OS=Rattus norvegicus
Align length 16
Score (bit) 33.9
E-value 0.54
Report
BLASTX 2.2.19 [Nov-02-2008]


Reference: Altschul, Stephen F., Thomas L. Madden, Alejandro A. Schaffer,
Jinghui Zhang, Zheng Zhang, Webb Miller, and David J. Lipman (1997),
"Gapped BLAST and PSI-BLAST: a new generation of protein database search
programs", Nucleic Acids Res. 25:3389-3402.

Query= BP918157|Adiantum capillus-veneris mRNA, clone:
YMU001_000110_C02.
(550 letters)

Database: uniprot_sprot.fasta
412,525 sequences; 148,809,765 total letters

Searching..................................................done



Score E
Sequences producing significant alignments: (bits) Value

sp|Q91XS8|ST17B_RAT Serine/threonine-protein kinase 17B OS=Rattu... 34 0.54
sp|Q8BG48|ST17B_MOUSE Serine/threonine-protein kinase 17B OS=Mus... 34 0.54
sp|O94768|ST17B_HUMAN Serine/threonine-protein kinase 17B OS=Hom... 33 0.70
sp|Q5RD27|SRPK1_PONAB Serine/threonine-protein kinase SRPK1 OS=P... 33 0.70
sp|Q96SB4|SRPK1_HUMAN Serine/threonine-protein kinase SRPK1 OS=H... 33 0.70
sp|O70551|SRPK1_MOUSE Serine/threonine-protein kinase SRPK1 OS=M... 33 1.2
sp|O54781|SRPK2_MOUSE Serine/threonine-protein kinase SRPK2 OS=M... 32 2.0
sp|Q9Z0G2|SRPK3_MOUSE Serine/threonine-protein kinase SRPK3 OS=M... 31 3.5
sp|Q9UPE1|SRPK3_HUMAN Serine/threonine-protein kinase SRPK3 OS=H... 31 3.5
sp|P12270|TPR_HUMAN Nucleoprotein TPR OS=Homo sapiens GN=TPR PE=... 31 4.6
sp|Q5VST9|OBSCN_HUMAN Obscurin OS=Homo sapiens GN=OBSCN PE=1 SV=3 31 4.6
sp|A1R4G4|PTH_ARTAT Peptidyl-tRNA hydrolase OS=Arthrobacter aure... 30 6.0
sp|A2AAJ9|OBSCN_MOUSE Obscurin OS=Mus musculus GN=Obscn PE=2 SV=2 30 7.8

>sp|Q91XS8|ST17B_RAT Serine/threonine-protein kinase 17B OS=Rattus
norvegicus GN=Stk17b PE=1 SV=1
Length = 371

Score = 33.9 bits (76), Expect = 0.54
Identities = 13/16 (81%), Positives = 13/16 (81%)
Frame = +2

Query: 5 PEKRPTASQCLLHSWL 52
PEKRPTA CL HSWL
Sbjct: 278 PEKRPTAESCLSHSWL 293


>sp|Q8BG48|ST17B_MOUSE Serine/threonine-protein kinase 17B OS=Mus
musculus GN=Stk17b PE=2 SV=1
Length = 372

Score = 33.9 bits (76), Expect = 0.54
Identities = 13/16 (81%), Positives = 13/16 (81%)
Frame = +2

Query: 5 PEKRPTASQCLLHSWL 52
PEKRPTA CL HSWL
Sbjct: 278 PEKRPTAESCLSHSWL 293


>sp|O94768|ST17B_HUMAN Serine/threonine-protein kinase 17B OS=Homo
sapiens GN=STK17B PE=1 SV=1
Length = 372

Score = 33.5 bits (75), Expect = 0.70
Identities = 19/55 (34%), Positives = 27/55 (49%)
Frame = +2

Query: 5 PEKRPTASQCLLHSWLNVGLHNTQAQFLSNQGQVGSEVQNERSTVVGTKDAMEKA 169
PEKRPTA CL HSW L + L + + S Q + +V ++D K+
Sbjct: 278 PEKRPTAEICLSHSW----LQQWDFENLFHPEETSSSSQTQDHSVRSSEDKTSKS 328


>sp|Q5RD27|SRPK1_PONAB Serine/threonine-protein kinase SRPK1
OS=Pongo abelii GN=SRPK1 PE=2 SV=2
Length = 655

Score = 33.5 bits (75), Expect = 0.70
Identities = 12/18 (66%), Positives = 15/18 (83%)
Frame = +2

Query: 2 VPEKRPTASQCLLHSWLN 55
+PEKR TA++CL H WLN
Sbjct: 637 IPEKRATAAECLRHPWLN 654


>sp|Q96SB4|SRPK1_HUMAN Serine/threonine-protein kinase SRPK1 OS=Homo
sapiens GN=SRPK1 PE=1 SV=2
Length = 655

Score = 33.5 bits (75), Expect = 0.70
Identities = 12/18 (66%), Positives = 15/18 (83%)
Frame = +2

Query: 2 VPEKRPTASQCLLHSWLN 55
+PEKR TA++CL H WLN
Sbjct: 637 IPEKRATAAECLRHPWLN 654


>sp|O70551|SRPK1_MOUSE Serine/threonine-protein kinase SRPK1 OS=Mus
musculus GN=Srpk1 PE=1 SV=2
Length = 648

Score = 32.7 bits (73), Expect = 1.2
Identities = 12/18 (66%), Positives = 15/18 (83%)
Frame = +2

Query: 2 VPEKRPTASQCLLHSWLN 55
+PEKR TA++CL H WLN
Sbjct: 630 MPEKRATAAECLRHPWLN 647


>sp|O54781|SRPK2_MOUSE Serine/threonine-protein kinase SRPK2 OS=Mus
musculus GN=Srpk2 PE=1 SV=2
Length = 681

Score = 32.0 bits (71), Expect = 2.0
Identities = 12/18 (66%), Positives = 14/18 (77%)
Frame = +2

Query: 2 VPEKRPTASQCLLHSWLN 55
VPEKR +A +CL H WLN
Sbjct: 663 VPEKRASAGECLRHPWLN 680


>sp|Q9Z0G2|SRPK3_MOUSE Serine/threonine-protein kinase SRPK3 OS=Mus
musculus GN=Srpk3 PE=2 SV=1
Length = 565

Score = 31.2 bits (69), Expect = 3.5
Identities = 11/18 (61%), Positives = 14/18 (77%)
Frame = +2

Query: 2 VPEKRPTASQCLLHSWLN 55
+PEKR +A+ CL H WLN
Sbjct: 547 IPEKRASAADCLQHPWLN 564


>sp|Q9UPE1|SRPK3_HUMAN Serine/threonine-protein kinase SRPK3 OS=Homo
sapiens GN=SRPK3 PE=2 SV=1
Length = 533

Score = 31.2 bits (69), Expect = 3.5
Identities = 11/18 (61%), Positives = 14/18 (77%)
Frame = +2

Query: 2 VPEKRPTASQCLLHSWLN 55
+PEKR +A+ CL H WLN
Sbjct: 515 IPEKRASAADCLQHPWLN 532


>sp|P12270|TPR_HUMAN Nucleoprotein TPR OS=Homo sapiens GN=TPR PE=1
SV=3
Length = 2363

Score = 30.8 bits (68), Expect = 4.6
Identities = 19/73 (26%), Positives = 34/73 (46%), Gaps = 3/73 (4%)
Frame = +2

Query: 8 EKRPTASQCLLHS---WLNVGLHNTQAQFLSNQGQVGSEVQNERSTVVGTKDAMEKAEEA 178
EKR + LLHS WLN L + L+ + G+E+ + + K+ + + EE
Sbjct: 180 EKRLEQEKELLHSQNTWLNTELKTKTDELLALGREKGNEILELKCNLENKKEEVSRLEEQ 239

Query: 179 MGNIVLASGQMDK 217
M + ++ + K
Sbjct: 240 MNGLKTSNEHLQK 252


tr_hit_id Q9LF89
Definition tr|Q9LF89|Q9LF89_ARATH Serine protein kinase-like OS=Arabidopsis thaliana
Align length 67
Score (bit) 49.3
E-value 0.0001
Report
BLASTX 2.2.19 [Nov-02-2008]


Reference: Altschul, Stephen F., Thomas L. Madden, Alejandro A. Schaffer,
Jinghui Zhang, Zheng Zhang, Webb Miller, and David J. Lipman (1997),
"Gapped BLAST and PSI-BLAST: a new generation of protein database search
programs", Nucleic Acids Res. 25:3389-3402.

Query= BP918157|Adiantum capillus-veneris mRNA, clone:
YMU001_000110_C02.
(550 letters)

Database: uniprot_trembl.fasta
7,341,751 sequences; 2,391,615,440 total letters

Searching..................................................done



Score E
Sequences producing significant alignments: (bits) Value

tr|Q9LF89|Q9LF89_ARATH Serine protein kinase-like OS=Arabidopsis... 49 1e-04
tr|Q9FYB3|Q9FYB3_ARATH SRPK4 OS=Arabidopsis thaliana GN=srpk4 PE... 49 1e-04
tr|Q94AX8|Q94AX8_ARATH AT3g53030/F8J2_200 OS=Arabidopsis thalian... 49 1e-04
tr|A7PPN4|A7PPN4_VITVI Chromosome chr8 scaffold_23, whole genome... 49 1e-04
tr|Q9FYC5|Q9FYC5_ARATH Putative uncharacterized protein F28D10_4... 46 0.001
tr|A7PQL7|A7PQL7_VITVI Chromosome chr6 scaffold_25, whole genome... 45 0.003
tr|Q6JJ37|Q6JJ37_IPOTF Putative serine/arginine (SR) protein kin... 44 0.007
tr|Q9FE52|Q9FE52_ARATH SRPK3 (Serine protein kinase-like protein... 43 0.010
tr|Q8LGG5|Q8LGG5_ARATH Serine protein kinase-like protein OS=Ara... 43 0.010
tr|Q0WRI9|Q0WRI9_ARATH Serine protein kinase like protein OS=Ara... 43 0.010
tr|B6U0K3|B6U0K3_MAIZE ATP binding protein OS=Zea mays PE=2 SV=1 41 0.037
tr|Q9SHL5|Q9SHL5_ARATH Putative uncharacterized protein At2g1753... 39 0.24
tr|Q9FYB4|Q9FYB4_ARATH SRPK1 OS=Arabidopsis thaliana GN=srpk1 PE... 37 0.53
tr|O81783|O81783_ARATH Protein kinase-like protein OS=Arabidopsi... 37 0.53
tr|A7PKW0|A7PKW0_VITVI Chromosome chr7 scaffold_20, whole genome... 37 0.90
tr|A5BCD5|A5BCD5_VITVI Putative uncharacterized protein OS=Vitis... 37 0.90
tr|Q8W306|Q8W306_ORYSA SRPK4 OS=Oryza sativa PE=4 SV=1 36 1.2
tr|Q10CW1|Q10CW1_ORYSJ Protein kinase family protein, putative, ... 36 1.2
tr|A2XM01|A2XM01_ORYSI Putative uncharacterized protein OS=Oryza... 36 1.2
tr|Q4S887|Q4S887_TETNG Chromosome 3 SCAF14707, whole genome shot... 35 2.6
tr|A4IHA0|A4IHA0_XENTR LOC100124819 protein OS=Xenopus tropicali... 35 2.6
tr|Q8S3K5|Q8S3K5_ELAOL Serine/threonine protein kinase SRPK1 (Fr... 35 2.6
tr|B5DS58|B5DS58_DROPS GA27948 OS=Drosophila pseudoobscura pseud... 35 2.6
tr|B4H9R0|B4H9R0_DROPE GL18373 OS=Drosophila persimilis GN=GL183... 35 2.6
tr|A1L2D3|A1L2D3_DANRE Serine/arginine-rich protein specific kin... 35 3.4
tr|Q7F0A0|Q7F0A0_ORYSJ Serine/threonine protein-like protein OS=... 35 3.4
tr|Q0D6J6|Q0D6J6_ORYSJ Os07g0472400 protein OS=Oryza sativa subs... 35 3.4
tr|B8B5Y8|B8B5Y8_ORYSI Putative uncharacterized protein OS=Oryza... 35 3.4
tr|B4G1A4|B4G1A4_MAIZE Putative uncharacterized protein OS=Zea m... 35 3.4
tr|A3BJM6|A3BJM6_ORYSJ Putative uncharacterized protein OS=Oryza... 35 3.4

>tr|Q9LF89|Q9LF89_ARATH Serine protein kinase-like OS=Arabidopsis
thaliana GN=F8J2_200 PE=4 SV=1
Length = 523

Score = 49.3 bits (116), Expect = 1e-04
Identities = 25/67 (37%), Positives = 35/67 (52%)
Frame = +2

Query: 2 VPEKRPTASQCLLHSWLNVGLHNTQAQFLSNQGQVGSEVQNERSTVVGTKDAMEKAEEAM 181
VPEKRPTA+QCLLH W+N G + + +N+R + E E M
Sbjct: 444 VPEKRPTAAQCLLHPWINSGPRSIKPSLKDENSDKLDTEKNKRE-----NEEQEAVEVKM 498

Query: 182 GNIVLAS 202
GN+V++S
Sbjct: 499 GNVVISS 505


>tr|Q9FYB3|Q9FYB3_ARATH SRPK4 OS=Arabidopsis thaliana GN=srpk4 PE=2
SV=1
Length = 529

Score = 49.3 bits (116), Expect = 1e-04
Identities = 25/67 (37%), Positives = 35/67 (52%)
Frame = +2

Query: 2 VPEKRPTASQCLLHSWLNVGLHNTQAQFLSNQGQVGSEVQNERSTVVGTKDAMEKAEEAM 181
VPEKRPTA+QCLLH W+N G + + +N+R + E E M
Sbjct: 450 VPEKRPTAAQCLLHPWINSGPRSIKPSLKDENSDKLDTEKNKRE-----NEEQEAVEVKM 504

Query: 182 GNIVLAS 202
GN+V++S
Sbjct: 505 GNVVISS 511


>tr|Q94AX8|Q94AX8_ARATH AT3g53030/F8J2_200 OS=Arabidopsis thaliana
PE=2 SV=1
Length = 529

Score = 49.3 bits (116), Expect = 1e-04
Identities = 25/67 (37%), Positives = 35/67 (52%)
Frame = +2

Query: 2 VPEKRPTASQCLLHSWLNVGLHNTQAQFLSNQGQVGSEVQNERSTVVGTKDAMEKAEEAM 181
VPEKRPTA+QCLLH W+N G + + +N+R + E E M
Sbjct: 450 VPEKRPTAAQCLLHPWINSGPRSIKPSLKDENSDKLDTEKNKRE-----NEEQEAVEVKM 504

Query: 182 GNIVLAS 202
GN+V++S
Sbjct: 505 GNVVISS 511


>tr|A7PPN4|A7PPN4_VITVI Chromosome chr8 scaffold_23, whole genome
shotgun sequence OS=Vitis vinifera GN=GSVIVT00021715001
PE=4 SV=1
Length = 557

Score = 49.3 bits (116), Expect = 1e-04
Identities = 28/67 (41%), Positives = 37/67 (55%)
Frame = +2

Query: 2 VPEKRPTASQCLLHSWLNVGLHNTQAQFLSNQGQVGSEVQNERSTVVGTKDAMEKAEEAM 181
VPEKRPTA+QCLLH W++ G + S + Q G V E+ KD E E M
Sbjct: 469 VPEKRPTAAQCLLHPWISAGPLLLEPSMPSVKIQAGESVICEKKK--REKDEREAMEIGM 526

Query: 182 GNIVLAS 202
GNI +++
Sbjct: 527 GNIAISA 533


>tr|Q9FYC5|Q9FYC5_ARATH Putative uncharacterized protein F28D10_40
OS=Arabidopsis thaliana GN=F28D10_40 PE=4 SV=1
Length = 534

Score = 46.2 bits (108), Expect = 0.001
Identities = 26/65 (40%), Positives = 31/65 (47%)
Frame = +2

Query: 2 VPEKRPTASQCLLHSWLNVGLHNTQAQFLSNQGQVGSEVQNERSTVVGTKDAMEKAEEAM 181
VPEKRPTA+QCL H W N G + L Q G E + KD E E +
Sbjct: 465 VPEKRPTAAQCLKHPWFNPGPRLLEPS-LKPQQPKGEEEGAANENIEKEKDEREAMEAGV 523

Query: 182 GNIVL 196
GNI +
Sbjct: 524 GNIAI 528


>tr|A7PQL7|A7PQL7_VITVI Chromosome chr6 scaffold_25, whole genome
shotgun sequence OS=Vitis vinifera GN=GSVIVT00022115001
PE=4 SV=1
Length = 470

Score = 44.7 bits (104), Expect = 0.003
Identities = 24/65 (36%), Positives = 31/65 (47%)
Frame = +2

Query: 2 VPEKRPTASQCLLHSWLNVGLHNTQAQFLSNQGQVGSEVQNERSTVVGTKDAMEKAEEAM 181
VPEKRPTA+QCL H W+N G + S V +R +D E E +
Sbjct: 391 VPEKRPTAAQCLTHPWINAGPRLREPSIASLPKATDGGVSEKRE-----RDEREAMEVGV 445

Query: 182 GNIVL 196
GNI +
Sbjct: 446 GNIAI 450


>tr|Q6JJ37|Q6JJ37_IPOTF Putative serine/arginine (SR) protein kinase
protein (Putative uncharacterized protein) OS=Ipomoea
trifida PE=4 SV=1
Length = 555

Score = 43.5 bits (101), Expect = 0.007
Identities = 26/65 (40%), Positives = 33/65 (50%)
Frame = +2

Query: 2 VPEKRPTASQCLLHSWLNVGLHNTQAQFLSNQGQVGSEVQNERSTVVGTKDAMEKAEEAM 181
VPEKRPTA+QCL H W+ G N ++N G E N + KD E E +
Sbjct: 479 VPEKRPTAAQCLTHPWIMGGPRNLVPSAINNSPPHGPE--NGKCI---EKDERETMEARV 533

Query: 182 GNIVL 196
GNI +
Sbjct: 534 GNIAI 538


>tr|Q9FE52|Q9FE52_ARATH SRPK3 (Serine protein kinase-like protein)
OS=Arabidopsis thaliana GN=srpk3 PE=2 SV=1
Length = 538

Score = 43.1 bits (100), Expect = 0.010
Identities = 28/80 (35%), Positives = 39/80 (48%), Gaps = 2/80 (2%)
Frame = +2

Query: 2 VPEKRPTASQCLLHSWLNVGLHNTQAQFLSNQGQVGSEVQNERSTVVGTKDAMEK--AEE 175
VPEKRPTA+QCL H WLN + + S+ Q E + E S K+ +E+ E
Sbjct: 454 VPEKRPTAAQCLTHPWLNPVPKSLKP---SSSPQNPKEEEEEASDEDKDKEKVEREAMEA 510

Query: 176 AMGNIVLASGQMDKDRLSGR 235
+GNI + + GR
Sbjct: 511 GVGNIAIDGSERKTSAREGR 530


>tr|Q8LGG5|Q8LGG5_ARATH Serine protein kinase-like protein
OS=Arabidopsis thaliana PE=2 SV=1
Length = 538

Score = 43.1 bits (100), Expect = 0.010
Identities = 28/80 (35%), Positives = 39/80 (48%), Gaps = 2/80 (2%)
Frame = +2

Query: 2 VPEKRPTASQCLLHSWLNVGLHNTQAQFLSNQGQVGSEVQNERSTVVGTKDAMEK--AEE 175
VPEKRPTA+QCL H WLN + + S+ Q E + E S K+ +E+ E
Sbjct: 454 VPEKRPTAAQCLTHPWLNPVPKSLKP---SSSPQNPKEEEEEASDEDKDKEKVEREAMEA 510

Query: 176 AMGNIVLASGQMDKDRLSGR 235
+GNI + + GR
Sbjct: 511 GVGNIAIDGSERKTSAREGR 530


>tr|Q0WRI9|Q0WRI9_ARATH Serine protein kinase like protein
OS=Arabidopsis thaliana GN=At5g22840 PE=2 SV=1
Length = 538

Score = 43.1 bits (100), Expect = 0.010
Identities = 28/80 (35%), Positives = 39/80 (48%), Gaps = 2/80 (2%)
Frame = +2

Query: 2 VPEKRPTASQCLLHSWLNVGLHNTQAQFLSNQGQVGSEVQNERSTVVGTKDAMEK--AEE 175
VPEKRPTA+QCL H WLN + + S+ Q E + E S K+ +E+ E
Sbjct: 454 VPEKRPTAAQCLTHPWLNPVPKSLKP---SSSPQNPKEEEEEASDEDKDKEKVEREAMEA 510

Query: 176 AMGNIVLASGQMDKDRLSGR 235
+GNI + + GR
Sbjct: 511 GVGNIAIDGSERKTSAREGR 530