BP918172
Clone id YMU001_000110_D05
Library
Length 506
Definition Adiantum capillus-veneris mRNA. clone: YMU001_000110_D05.
Accession
Tissue type prothallium
Developmental stage -
Contig ID
Sequence
AGCGTGTTGCATGGACAAAGGTTCTTCAAAGTCTCTCAGTTCAAGGTTTAACTTCTTCTG
GGAGTGGTGGGCTTGGCAATGATGGTAGTATCAGCACTGGTGTACAAGGGCTTTGCTAAA
AGAAAGATTCAAAACTTTCAATATCCAATTTGATGAGCTGTATCAGCGCCAAACACAATG
GTTTGTCCCAGATGCTGAGCTCCGCGAATCTTTACGCTTGGCTGTGGCGGAAGTGCTTAT
GTCAGCATATCGCTCCTTTCTGAAACACTTTGGTTCATTAATGGAGAGTGGCAAGAACCC
CCAGAAGTATGTAAGGTTCAGTCCTGAGAAGCTGGATGCTATGCTTGGAGAGCTGTTTGA
GGGAAAAACCAGAACAGAGCCACGGCGGTAGTAGTTCGTGCCTGGTGCTGCAAAGTGGTT
CTCTATCTTTTATGCCAGTTTTGTGAAATTTCATGGCTGGATCTGCTAAGGGTGTGGAGT
GGAGAGGTGTGTATAGTTCTTGGTGT
■■Homology search results ■■ -
sp_hit_id Q9UPT5
Definition sp|Q9UPT5|EXOC7_HUMAN Exocyst complex component 7 OS=Homo sapiens
Align length 85
Score (bit) 69.3
E-value 1.0e-11
Report
BLASTX 2.2.19 [Nov-02-2008]


Reference: Altschul, Stephen F., Thomas L. Madden, Alejandro A. Schaffer,
Jinghui Zhang, Zheng Zhang, Webb Miller, and David J. Lipman (1997),
"Gapped BLAST and PSI-BLAST: a new generation of protein database search
programs", Nucleic Acids Res. 25:3389-3402.

Query= BP918172|Adiantum capillus-veneris mRNA, clone:
YMU001_000110_D05.
(506 letters)

Database: uniprot_sprot.fasta
412,525 sequences; 148,809,765 total letters

Searching..................................................done



Score E
Sequences producing significant alignments: (bits) Value

sp|Q9UPT5|EXOC7_HUMAN Exocyst complex component 7 OS=Homo sapien... 69 1e-11
sp|O35250|EXOC7_MOUSE Exocyst complex component 7 OS=Mus musculu... 69 2e-11
sp|O54922|EXOC7_RAT Exocyst complex component 7 OS=Rattus norveg... 66 1e-10
sp|Q9VSJ8|EXOC7_DROME Exocyst complex component 7 OS=Drosophila ... 59 1e-08
sp|Q6CC70|EXO70_YARLI Exocyst complex protein EXO70 OS=Yarrowia ... 54 4e-07
sp|Q6CK11|EXO70_KLULA Exocyst complex protein EXO70 OS=Kluyverom... 47 7e-05
sp|Q6BT51|EXO70_DEBHA Exocyst complex protein EXO70 OS=Debaryomy... 44 3e-04
sp|Q5AZS0|EXO70_EMENI Exocyst complex protein exo70 OS=Emericell... 40 0.006
sp|Q4X0X6|EXO70_ASPFU Exocyst complex protein exo70 OS=Aspergill... 40 0.008
sp|Q5AH25|EXO70_CANAL Exocyst complex protein EXO70 OS=Candida a... 37 0.053
sp|P30533|AMRP_HUMAN Alpha-2-macroglobulin receptor-associated p... 33 0.58
sp|Q10339|EXO70_SCHPO Exocyst complex component exo70 OS=Schizos... 33 1.00
sp|Q06676|FIT2A_YEAST Protein FIT2 homolog A OS=Saccharomyces ce... 32 1.3
sp|Q1LM60|MNMC_RALME tRNA 5-methylaminomethyl-2-thiouridine bios... 32 2.2
sp|Q0KBK6|MNMC_RALEH tRNA 5-methylaminomethyl-2-thiouridine bios... 31 2.9
sp|P06200|PHLC_PSEAE Hemolytic phospholipase C OS=Pseudomonas ae... 31 3.8
sp|Q4ILI9|EXO70_GIBZE Exocyst complex protein EXO70 OS=Gibberell... 31 3.8
sp|Q472D5|MNMC_RALEJ tRNA 5-methylaminomethyl-2-thiouridine bios... 30 4.9
sp|P53793|SC5A3_BOVIN Sodium/myo-inositol cotransporter OS=Bos t... 30 8.4

>sp|Q9UPT5|EXOC7_HUMAN Exocyst complex component 7 OS=Homo sapiens
GN=EXOC7 PE=1 SV=3
Length = 735

Score = 69.3 bits (168), Expect = 1e-11
Identities = 33/85 (38%), Positives = 54/85 (63%)
Frame = +2

Query: 107 RALLKERFKTFNIQFDELYQRQTQWFVPDAELRESLRLAVAEVLMSAYRSFLKHFGSLME 286
R ++KERFK FN +EL + Q W +PD E R+ +R A ++ Y +FL+ FGS+
Sbjct: 649 RQIIKERFKGFNDGLEELCKIQKAWAIPDTEQRDRIRQAQKTIVKETYGAFLQKFGSVPF 708

Query: 287 SGKNPQKYVRFSPEKLDAMLGELFE 361
+ KNP+KY+++ E++ M+ LF+
Sbjct: 709 T-KNPEKYIKYGVEQVGDMIDRLFD 732


>sp|O35250|EXOC7_MOUSE Exocyst complex component 7 OS=Mus musculus
GN=Exoc7 PE=1 SV=2
Length = 697

Score = 68.6 bits (166), Expect = 2e-11
Identities = 32/85 (37%), Positives = 54/85 (63%)
Frame = +2

Query: 107 RALLKERFKTFNIQFDELYQRQTQWFVPDAELRESLRLAVAEVLMSAYRSFLKHFGSLME 286
R ++KERFK FN +EL + Q W +PD E R+ +R A +++ Y +FL +GS+
Sbjct: 611 RQMIKERFKGFNDGLEELCKIQKVWAIPDTEQRDKIRQAQKDIVKETYGAFLHRYGSVPF 670

Query: 287 SGKNPQKYVRFSPEKLDAMLGELFE 361
+ KNP+KY+++ E++ M+ LF+
Sbjct: 671 T-KNPEKYIKYRVEQVGDMIDRLFD 694


>sp|O54922|EXOC7_RAT Exocyst complex component 7 OS=Rattus
norvegicus GN=Exoc7 PE=2 SV=1
Length = 653

Score = 65.9 bits (159), Expect = 1e-10
Identities = 31/85 (36%), Positives = 52/85 (61%)
Frame = +2

Query: 107 RALLKERFKTFNIQFDELYQRQTQWFVPDAELRESLRLAVAEVLMSAYRSFLKHFGSLME 286
R ++KERFK FN +EL + Q W +PD E R+ +R A ++ Y +FL + S+
Sbjct: 567 RQMIKERFKGFNDGLEELCKIQKAWAIPDTEQRDKIRQAQKSIVKETYGAFLHRYSSVPF 626

Query: 287 SGKNPQKYVRFSPEKLDAMLGELFE 361
+ KNP+KY+++ E++ M+ LF+
Sbjct: 627 T-KNPEKYIKYRVEQVGDMIDRLFD 650


>sp|Q9VSJ8|EXOC7_DROME Exocyst complex component 7 OS=Drosophila
melanogaster GN=exo70 PE=1 SV=2
Length = 693

Score = 58.9 bits (141), Expect = 1e-08
Identities = 31/85 (36%), Positives = 50/85 (58%)
Frame = +2

Query: 107 RALLKERFKTFNIQFDELYQRQTQWFVPDAELRESLRLAVAEVLMSAYRSFLKHFGSLME 286
R++LKERF FN F+E + Q +PD LRE ++ E ++ Y F + + +
Sbjct: 607 RSVLKERFSNFNKDFEEACKIQRGISIPDVILREGIKRDNVEHILPIYNRFYEIYSGVHF 666

Query: 287 SGKNPQKYVRFSPEKLDAMLGELFE 361
S KNP KYV++ +++AML +LF+
Sbjct: 667 S-KNPDKYVKYRQHEINAMLSKLFD 690


>sp|Q6CC70|EXO70_YARLI Exocyst complex protein EXO70 OS=Yarrowia
lipolytica GN=EXO70 PE=3 SV=1
Length = 603

Score = 53.9 bits (128), Expect = 4e-07
Identities = 28/83 (33%), Positives = 46/83 (55%)
Frame = +2

Query: 107 RALLKERFKTFNIQFDELYQRQTQWFVPDAELRESLRLAVAEVLMSAYRSFLKHFGSLME 286
R L+K++FKTFN F+EL + + + D L++ L VA + +R + KH G +
Sbjct: 521 RELVKDKFKTFNADFEELVKNHKTYTITDPALKQLLAKEVAFICPLYHRYYDKHIGG--D 578

Query: 287 SGKNPQKYVRFSPEKLDAMLGEL 355
KN KY+++ + D +L EL
Sbjct: 579 FSKNVDKYIKYDKAQFDRVLQEL 601


>sp|Q6CK11|EXO70_KLULA Exocyst complex protein EXO70
OS=Kluyveromyces lactis GN=EXO70 PE=3 SV=1
Length = 619

Score = 46.6 bits (109), Expect = 7e-05
Identities = 21/82 (25%), Positives = 47/82 (57%)
Frame = +2

Query: 116 LKERFKTFNIQFDELYQRQTQWFVPDAELRESLRLAVAEVLMSAYRSFLKHFGSLMESGK 295
+KE+FK F+ F++L R + + D L++ LR + +++ Y F + +S K
Sbjct: 541 IKEKFKKFHDGFEDLVSRSKSYRISDPALKKILRQEILSLVLPMYERFYNRY---KDSFK 597

Query: 296 NPQKYVRFSPEKLDAMLGELFE 361
+P+K+++++P +L +L + +
Sbjct: 598 HPRKHIKYTPSELMNVLNTIIK 619


>sp|Q6BT51|EXO70_DEBHA Exocyst complex protein EXO70 OS=Debaryomyces
hansenii GN=EXO70 PE=3 SV=2
Length = 613

Score = 44.3 bits (103), Expect = 3e-04
Identities = 22/79 (27%), Positives = 43/79 (54%)
Frame = +2

Query: 116 LKERFKTFNIQFDELYQRQTQWFVPDAELRESLRLAVAEVLMSAYRSFLKHFGSLMESGK 295
+K+ FK FN F++ + ++ + D LR L + +++M+AY +GS E K
Sbjct: 534 IKDLFKNFNESFEDALRNYEKYNITDVNLRAYLSGEIKKLIMNAYFKLYDKYGS-GEFTK 592

Query: 296 NPQKYVRFSPEKLDAMLGE 352
N KY++++ + + +L E
Sbjct: 593 NKAKYIKYNKHQFEQILNE 611


>sp|Q5AZS0|EXO70_EMENI Exocyst complex protein exo70 OS=Emericella
nidulans GN=exo70 PE=3 SV=1
Length = 631

Score = 40.0 bits (92), Expect = 0.006
Identities = 25/80 (31%), Positives = 37/80 (46%)
Frame = +2

Query: 116 LKERFKTFNIQFDELYQRQTQWFVPDAELRESLRLAVAEVLMSAYRSFLKHFGSLMESGK 295
+K++FK FN FD+L R +++ + E+R L V VL Y F + L K
Sbjct: 555 IKDKFKAFNASFDDLVARHKSFYM-EREVRSVLAREVQAVLEPLYARFYDRYHEL---DK 610

Query: 296 NPQKYVRFSPEKLDAMLGEL 355
KY ++ L A L L
Sbjct: 611 GRGKYTKYDKGSLSAQLASL 630


>sp|Q4X0X6|EXO70_ASPFU Exocyst complex protein exo70 OS=Aspergillus
fumigatus GN=exo70 PE=3 SV=1
Length = 628

Score = 39.7 bits (91), Expect = 0.008
Identities = 27/80 (33%), Positives = 37/80 (46%)
Frame = +2

Query: 116 LKERFKTFNIQFDELYQRQTQWFVPDAELRESLRLAVAEVLMSAYRSFLKHFGSLMESGK 295
+K++FK FN FDEL R ++ + E+R L V VL Y F + E K
Sbjct: 552 IKDKFKAFNASFDELVNRHKALYM-EREVRGVLAREVQAVLEPLYARFWDRY---HEIDK 607

Query: 296 NPQKYVRFSPEKLDAMLGEL 355
KYV++ L A L L
Sbjct: 608 GRGKYVKYDKGSLSAQLAAL 627


>sp|Q5AH25|EXO70_CANAL Exocyst complex protein EXO70 OS=Candida
albicans GN=EXO70 PE=3 SV=1
Length = 667

Score = 37.0 bits (84), Expect = 0.053
Identities = 20/79 (25%), Positives = 40/79 (50%)
Frame = +2

Query: 116 LKERFKTFNIQFDELYQRQTQWFVPDAELRESLRLAVAEVLMSAYRSFLKHFGSLMESGK 295
+K+ FK FN F+E ++ DA L++ L + +++++ Y +G+ + K
Sbjct: 588 VKDLFKNFNESFEEALFNYQKYNFGDAILKKYLSNEIKKLILNTYFKLYDKYGN-SDFTK 646

Query: 296 NPQKYVRFSPEKLDAMLGE 352
N KYV++ + +L E
Sbjct: 647 NKSKYVKYDKLNFEKLLNE 665


tr_hit_id Q9LZD3
Definition tr|Q9LZD3|Q9LZD3_ARATH Putative uncharacterized protein F12E4_320 (Putative uncharacterized protein At5g03540) OS=Arabidopsis thaliana
Align length 95
Score (bit) 147.0
E-value 1.0e-34
Report
BLASTX 2.2.19 [Nov-02-2008]


Reference: Altschul, Stephen F., Thomas L. Madden, Alejandro A. Schaffer,
Jinghui Zhang, Zheng Zhang, Webb Miller, and David J. Lipman (1997),
"Gapped BLAST and PSI-BLAST: a new generation of protein database search
programs", Nucleic Acids Res. 25:3389-3402.

Query= BP918172|Adiantum capillus-veneris mRNA, clone:
YMU001_000110_D05.
(506 letters)

Database: uniprot_trembl.fasta
7,341,751 sequences; 2,391,615,440 total letters

Searching..................................................done



Score E
Sequences producing significant alignments: (bits) Value

tr|Q9LZD3|Q9LZD3_ARATH Putative uncharacterized protein F12E4_32... 147 1e-34
tr|B3H609|B3H609_ARATH Uncharacterized protein At5g03540.2 OS=Ar... 147 1e-34
tr|A9NWM1|A9NWM1_PICSI Putative uncharacterized protein OS=Picea... 148 2e-34
tr|Q9FHC6|Q9FHC6_ARATH Emb|CAB83315.1 OS=Arabidopsis thaliana PE... 145 1e-33
tr|A7QHV3|A7QHV3_VITVI Chromosome undetermined scaffold_100, who... 141 2e-32
tr|A7PP53|A7PP53_VITVI Chromosome chr8 scaffold_23, whole genome... 140 5e-32
tr|A5AUC0|A5AUC0_VITVI Putative uncharacterized protein OS=Vitis... 140 5e-32
tr|Q2RAC2|Q2RAC2_ORYSJ Exocyst subunit EXO70 family protein, put... 135 1e-30
tr|B8BJ75|B8BJ75_ORYSI Putative uncharacterized protein OS=Oryza... 135 1e-30
tr|A3C8U0|A3C8U0_ORYSJ Putative uncharacterized protein OS=Oryza... 135 1e-30
tr|B6SVA0|B6SVA0_MAIZE Protein binding protein OS=Zea mays PE=2 ... 133 4e-30
tr|B4FXP8|B4FXP8_MAIZE Putative uncharacterized protein OS=Zea m... 133 4e-30
tr|A9S081|A9S081_PHYPA Predicted protein OS=Physcomitrella paten... 126 5e-28
tr|Q2QXF0|Q2QXF0_ORYSJ Os12g0159700 protein OS=Oryza sativa subs... 125 1e-27
tr|A3CF59|A3CF59_ORYSJ Putative uncharacterized protein OS=Oryza... 125 1e-27
tr|A2ZIA7|A2ZIA7_ORYSI Putative uncharacterized protein OS=Oryza... 125 1e-27
tr|Q9FHC5|Q9FHC5_ARATH Emb|CAB83315.1 OS=Arabidopsis thaliana GN... 124 2e-27
tr|Q7XPT8|Q7XPT8_ORYSJ Os04g0685600 protein OS=Oryza sativa subs... 118 2e-25
tr|B8ART3|B8ART3_ORYSI Putative uncharacterized protein OS=Oryza... 118 2e-25
tr|A9RYU9|A9RYU9_PHYPA Predicted protein OS=Physcomitrella paten... 104 2e-21
tr|Q7XPT9|Q7XPT9_ORYSJ OSJNBa0088H09.17 protein OS=Oryza sativa ... 103 4e-21
tr|Q259N7|Q259N7_ORYSA H0723C07.2 protein (H0913C04.13 protein) ... 103 4e-21
tr|B8ART2|B8ART2_ORYSI Putative uncharacterized protein OS=Oryza... 103 4e-21
tr|A3AYT9|A3AYT9_ORYSJ Putative uncharacterized protein OS=Oryza... 103 4e-21
tr|A9SA36|A9SA36_PHYPA Predicted protein OS=Physcomitrella paten... 103 6e-21
tr|B6SVR8|B6SVR8_MAIZE Protein binding protein OS=Zea mays PE=2 ... 101 2e-20
tr|Q7XVB9|Q7XVB9_ORYSJ Os04g0382200 protein OS=Oryza sativa subs... 100 5e-20
tr|A3AT49|A3AT49_ORYSJ Putative uncharacterized protein OS=Oryza... 100 5e-20
tr|A2XSN9|A2XSN9_ORYSI Putative uncharacterized protein OS=Oryza... 100 5e-20
tr|Q6K647|Q6K647_ORYSJ Os02g0505400 protein OS=Oryza sativa subs... 99 1e-19

>tr|Q9LZD3|Q9LZD3_ARATH Putative uncharacterized protein F12E4_320
(Putative uncharacterized protein At5g03540)
OS=Arabidopsis thaliana GN=F12E4_320 PE=2 SV=1
Length = 638

Score = 147 bits (372), Expect(2) = 1e-34
Identities = 70/95 (73%), Positives = 83/95 (87%)
Frame = +2

Query: 104 TRALLKERFKTFNIQFDELYQRQTQWFVPDAELRESLRLAVAEVLMSAYRSFLKHFGSLM 283
+R LLKERFK FN+QFDEL+QRQ+QW VPD ELRESLRLAVAEVL+ AYRSFLK FG L+
Sbjct: 544 SRGLLKERFKMFNMQFDELHQRQSQWTVPDTELRESLRLAVAEVLLPAYRSFLKRFGPLV 603

Query: 284 ESGKNPQKYVRFSPEKLDAMLGELFEGKTRTEPRR 388
ESGKNPQKY++++ E L+ +LGELFEGK+ EPRR
Sbjct: 604 ESGKNPQKYIKYTAEDLERLLGELFEGKSMNEPRR 638



Score = 22.3 bits (46), Expect(2) = 1e-34
Identities = 8/9 (88%), Positives = 9/9 (100%)
Frame = +3

Query: 3 RVAWTKVLQ 29
RVAWTK+LQ
Sbjct: 512 RVAWTKILQ 520


>tr|B3H609|B3H609_ARATH Uncharacterized protein At5g03540.2
OS=Arabidopsis thaliana GN=At5g03540 PE=4 SV=1
Length = 523

Score = 147 bits (372), Expect(2) = 1e-34
Identities = 70/95 (73%), Positives = 83/95 (87%)
Frame = +2

Query: 104 TRALLKERFKTFNIQFDELYQRQTQWFVPDAELRESLRLAVAEVLMSAYRSFLKHFGSLM 283
+R LLKERFK FN+QFDEL+QRQ+QW VPD ELRESLRLAVAEVL+ AYRSFLK FG L+
Sbjct: 429 SRGLLKERFKMFNMQFDELHQRQSQWTVPDTELRESLRLAVAEVLLPAYRSFLKRFGPLV 488

Query: 284 ESGKNPQKYVRFSPEKLDAMLGELFEGKTRTEPRR 388
ESGKNPQKY++++ E L+ +LGELFEGK+ EPRR
Sbjct: 489 ESGKNPQKYIKYTAEDLERLLGELFEGKSMNEPRR 523



Score = 22.3 bits (46), Expect(2) = 1e-34
Identities = 8/9 (88%), Positives = 9/9 (100%)
Frame = +3

Query: 3 RVAWTKVLQ 29
RVAWTK+LQ
Sbjct: 397 RVAWTKILQ 405


>tr|A9NWM1|A9NWM1_PICSI Putative uncharacterized protein OS=Picea
sitchensis PE=2 SV=1
Length = 647

Score = 148 bits (373), Expect = 2e-34
Identities = 70/95 (73%), Positives = 83/95 (87%)
Frame = +2

Query: 104 TRALLKERFKTFNIQFDELYQRQTQWFVPDAELRESLRLAVAEVLMSAYRSFLKHFGSLM 283
+RALLKERFK FN+QF+EL+QRQTQW VPD ELRESLRLAVAEVL+ AYR FLK FGSL+
Sbjct: 553 SRALLKERFKAFNMQFEELHQRQTQWTVPDNELRESLRLAVAEVLLPAYRQFLKRFGSLL 612

Query: 284 ESGKNPQKYVRFSPEKLDAMLGELFEGKTRTEPRR 388
++GKNPQKY++++ E LD MLGE FEGK R +PRR
Sbjct: 613 DNGKNPQKYIKYTAEDLDRMLGEFFEGKPRGDPRR 647


>tr|Q9FHC6|Q9FHC6_ARATH Emb|CAB83315.1 OS=Arabidopsis thaliana PE=4
SV=1
Length = 608

Score = 145 bits (366), Expect = 1e-33
Identities = 69/95 (72%), Positives = 83/95 (87%)
Frame = +2

Query: 104 TRALLKERFKTFNIQFDELYQRQTQWFVPDAELRESLRLAVAEVLMSAYRSFLKHFGSLM 283
+RA +K+RFKTFN QF+EL+QRQ QW VPD+ELRESLRLAVAEVL+ A+RSFLK FG ++
Sbjct: 514 SRASVKDRFKTFNSQFEELHQRQCQWTVPDSELRESLRLAVAEVLLPAFRSFLKRFGPMI 573

Query: 284 ESGKNPQKYVRFSPEKLDAMLGELFEGKTRTEPRR 388
ESGKNPQKY+RFSPE L+ ML E FEGKT +EP+R
Sbjct: 574 ESGKNPQKYIRFSPEDLERMLNEFFEGKTWSEPKR 608


>tr|A7QHV3|A7QHV3_VITVI Chromosome undetermined scaffold_100, whole
genome shotgun sequence OS=Vitis vinifera
GN=GSVIVT00013809001 PE=4 SV=1
Length = 650

Score = 141 bits (356), Expect = 2e-32
Identities = 65/95 (68%), Positives = 83/95 (87%)
Frame = +2

Query: 104 TRALLKERFKTFNIQFDELYQRQTQWFVPDAELRESLRLAVAEVLMSAYRSFLKHFGSLM 283
+RA++K+RFKTFN+QF+EL+Q+Q+QW VPD ELRESLRLAVAEVL+ AYR+F+K FG L+
Sbjct: 556 SRAMVKDRFKTFNMQFEELHQKQSQWTVPDTELRESLRLAVAEVLLPAYRNFIKRFGPLV 615

Query: 284 ESGKNPQKYVRFSPEKLDAMLGELFEGKTRTEPRR 388
ESGKNPQKY+RF+ E L+ MLGE FEG+T E +R
Sbjct: 616 ESGKNPQKYIRFTAEDLERMLGEFFEGRTLNEAKR 650


>tr|A7PP53|A7PP53_VITVI Chromosome chr8 scaffold_23, whole genome
shotgun sequence OS=Vitis vinifera GN=GSVIVT00021515001
PE=4 SV=1
Length = 648

Score = 140 bits (352), Expect = 5e-32
Identities = 64/95 (67%), Positives = 83/95 (87%)
Frame = +2

Query: 104 TRALLKERFKTFNIQFDELYQRQTQWFVPDAELRESLRLAVAEVLMSAYRSFLKHFGSLM 283
+RA++K+R+KTFNIQF+EL+QRQ+QW VPD+ELRESLRLAVAEVL+ AYRSF+K FG ++
Sbjct: 554 SRAMVKDRYKTFNIQFEELHQRQSQWTVPDSELRESLRLAVAEVLLPAYRSFIKRFGPMI 613

Query: 284 ESGKNPQKYVRFSPEKLDAMLGELFEGKTRTEPRR 388
E+GKNP KY+R++PE L+ ML E FEGKT E +R
Sbjct: 614 ENGKNPHKYIRYTPEDLEHMLSEFFEGKTLNELKR 648


>tr|A5AUC0|A5AUC0_VITVI Putative uncharacterized protein OS=Vitis
vinifera GN=VITISV_039782 PE=4 SV=1
Length = 643

Score = 140 bits (352), Expect = 5e-32
Identities = 64/95 (67%), Positives = 83/95 (87%)
Frame = +2

Query: 104 TRALLKERFKTFNIQFDELYQRQTQWFVPDAELRESLRLAVAEVLMSAYRSFLKHFGSLM 283
+RA++K+R+KTFNIQF+EL+QRQ+QW VPD+ELRESLRLAVAEVL+ AYRSF+K FG ++
Sbjct: 549 SRAMVKDRYKTFNIQFEELHQRQSQWTVPDSELRESLRLAVAEVLLPAYRSFIKRFGPMI 608

Query: 284 ESGKNPQKYVRFSPEKLDAMLGELFEGKTRTEPRR 388
E+GKNP KY+R++PE L+ ML E FEGKT E +R
Sbjct: 609 ENGKNPHKYIRYTPEDLEHMLSEFFEGKTLNELKR 643


>tr|Q2RAC2|Q2RAC2_ORYSJ Exocyst subunit EXO70 family protein,
putative, expressed OS=Oryza sativa subsp. japonica
GN=Os11g0157400 PE=2 SV=2
Length = 643

Score = 135 bits (340), Expect = 1e-30
Identities = 62/95 (65%), Positives = 82/95 (86%)
Frame = +2

Query: 104 TRALLKERFKTFNIQFDELYQRQTQWFVPDAELRESLRLAVAEVLMSAYRSFLKHFGSLM 283
+RA++KERFK+FN+QF+EL+ +Q+QW VPD ELRESLRLAVAEVL+ AYRSF+K FG+L+
Sbjct: 549 SRAMIKERFKSFNMQFEELHAKQSQWIVPDQELRESLRLAVAEVLLPAYRSFVKRFGNLV 608

Query: 284 ESGKNPQKYVRFSPEKLDAMLGELFEGKTRTEPRR 388
E+GKNP KYVR+SPE ++ +LGE FEG+ E +R
Sbjct: 609 ENGKNPHKYVRYSPEMVEQLLGEFFEGQQWGEQKR 643


>tr|B8BJ75|B8BJ75_ORYSI Putative uncharacterized protein OS=Oryza
sativa subsp. indica GN=OsI_35189 PE=4 SV=1
Length = 643

Score = 135 bits (340), Expect = 1e-30
Identities = 62/95 (65%), Positives = 82/95 (86%)
Frame = +2

Query: 104 TRALLKERFKTFNIQFDELYQRQTQWFVPDAELRESLRLAVAEVLMSAYRSFLKHFGSLM 283
+RA++KERFK+FN+QF+EL+ +Q+QW VPD ELRESLRLAVAEVL+ AYRSF+K FG+L+
Sbjct: 549 SRAMIKERFKSFNMQFEELHAKQSQWIVPDQELRESLRLAVAEVLLPAYRSFVKRFGNLV 608

Query: 284 ESGKNPQKYVRFSPEKLDAMLGELFEGKTRTEPRR 388
E+GKNP KYVR+SPE ++ +LGE FEG+ E +R
Sbjct: 609 ENGKNPHKYVRYSPEMVEQLLGEFFEGQQWGEQKR 643


>tr|A3C8U0|A3C8U0_ORYSJ Putative uncharacterized protein OS=Oryza
sativa subsp. japonica GN=OsJ_031712 PE=4 SV=1
Length = 668

Score = 135 bits (340), Expect = 1e-30
Identities = 62/95 (65%), Positives = 82/95 (86%)
Frame = +2

Query: 104 TRALLKERFKTFNIQFDELYQRQTQWFVPDAELRESLRLAVAEVLMSAYRSFLKHFGSLM 283
+RA++KERFK+FN+QF+EL+ +Q+QW VPD ELRESLRLAVAEVL+ AYRSF+K FG+L+
Sbjct: 574 SRAMIKERFKSFNMQFEELHAKQSQWIVPDQELRESLRLAVAEVLLPAYRSFVKRFGNLV 633

Query: 284 ESGKNPQKYVRFSPEKLDAMLGELFEGKTRTEPRR 388
E+GKNP KYVR+SPE ++ +LGE FEG+ E +R
Sbjct: 634 ENGKNPHKYVRYSPEMVEQLLGEFFEGQQWGEQKR 668