BP918231
Clone id YMU001_000111_A09
Library
Length 532
Definition Adiantum capillus-veneris mRNA. clone: YMU001_000111_A09.
Accession
Tissue type prothallium
Developmental stage -
Contig ID
Sequence
TTTTTTTTTTCATATAAAACTGTTACAGGTCCCATTCCTGGGTATCCAAAAACAATGCCC
CATTTCTGGGTTATCGAAACAATCCCCACAAAGAGAAGGTGTGCATTTGCTAAGCTGTAC
CTATAAGCTTAAACTAAGAATGTGGGTGACATCAATCAGGAGAATGCACAATCAACATAC
CTCTTTAGGTGAACTTCTCTAAATGGAACGCACTACTTACCCAACATCATCTTCACAAAC
TCCTCGTAATTAATCTGACCATCCCCATCGACATCAGCCTCTCTAATCATCTCGTCAACC
TCATCATCACTTAGCTTCTCCCCAAGGTTGGTCATAACATGGCGCAGCTCAGCAGCTGAA
ATAAACCCATTTTGATCCTTGTCAAACACACGAAAAGCCTCCTTGAGCTCTTCCTCAGAG
TCCGTATCCTTCATTTTGCGGGCCATGAGGTTGAGAAACTCAGCAAAATCAATGGTTCCG
TTTCCATCTGCATCAACCTCGTTAATCATATCCTGCAGCTCTGCTTCAGTGG
■■Homology search results ■■ -
sp_hit_id Q03509
Definition sp|Q03509|CALM6_ARATH Calmodulin-6 OS=Arabidopsis thaliana
Align length 105
Score (bit) 201.0
E-value 1.0e-51
Report
BLASTX 2.2.19 [Nov-02-2008]


Reference: Altschul, Stephen F., Thomas L. Madden, Alejandro A. Schaffer,
Jinghui Zhang, Zheng Zhang, Webb Miller, and David J. Lipman (1997),
"Gapped BLAST and PSI-BLAST: a new generation of protein database search
programs", Nucleic Acids Res. 25:3389-3402.

Query= BP918231|Adiantum capillus-veneris mRNA, clone:
YMU001_000111_A09.
(522 letters)

Database: uniprot_sprot.fasta
412,525 sequences; 148,809,765 total letters

Searching..................................................done



Score E
Sequences producing significant alignments: (bits) Value

sp|Q03509|CALM6_ARATH Calmodulin-6 OS=Arabidopsis thaliana GN=CA... 201 1e-51
sp|P04353|CALM_SPIOL Calmodulin OS=Spinacia oleracea PE=1 SV=2 200 3e-51
sp|P17928|CALM_MEDSA Calmodulin OS=Medicago sativa GN=CAL1 PE=2 ... 200 3e-51
sp|P62201|CALM_LILLO Calmodulin OS=Lilium longiflorum PE=2 SV=2 200 3e-51
sp|P62162|CALM_HORVU Calmodulin OS=Hordeum vulgare GN=CAM PE=2 SV=2 200 3e-51
sp|P93171|CALM_HELAN Calmodulin OS=Helianthus annuus GN=CAM PE=2... 200 3e-51
sp|Q7Y052|CALM_EUPCH Calmodulin OS=Euphorbia characias PE=2 SV=4 200 3e-51
sp|P62202|CALM_BRYDI Calmodulin OS=Bryonia dioica PE=2 SV=2 200 3e-51
sp|P59220|CALM7_ARATH Calmodulin-7 OS=Arabidopsis thaliana GN=CA... 200 3e-51
sp|P62163|CALM2_SOYBN Calmodulin-2 OS=Glycine max GN=CAM-2 PE=1 ... 200 3e-51
sp|P62199|CALM1_PETHY Calmodulin-1 OS=Petunia hybrida GN=CAM81 P... 200 3e-51
sp|Q0JNS6|CALM1_ORYSJ Calmodulin-1 OS=Oryza sativa subsp. japoni... 200 3e-51
sp|A2WN93|CALM1_ORYSI Calmodulin-1 OS=Oryza sativa subsp. indica... 200 3e-51
sp|P62200|CALM1_DAUCA Calmodulin-1/11/16 OS=Daucus carota GN=CAM... 200 3e-51
sp|P93087|CALM_CAPAN Calmodulin OS=Capsicum annuum GN=CCM1 PE=2 ... 199 7e-51
sp|Q7DMN9|CALM5_SOLTU Calmodulin-5/6/7/8 OS=Solanum tuberosum GN... 199 7e-51
sp|A2WNH1|CALM3_ORYSI Calmodulin-3 OS=Oryza sativa subsp. indica... 199 7e-51
sp|Q7DMP0|CALM2_SOLTU Calmodulin-2/4 (Fragment) OS=Solanum tuber... 199 7e-51
sp|Q6F332|CALM2_ORYSJ Calmodulin-2 OS=Oryza sativa subsp. japoni... 199 7e-51
sp|A2Y609|CALM2_ORYSI Calmodulin-2 OS=Oryza sativa subsp. indica... 199 7e-51
sp|P25069|CALM2_ARATH Calmodulin-2/3/5 OS=Arabidopsis thaliana G... 199 7e-51
sp|P04464|CALM_WHEAT Calmodulin OS=Triticum aestivum PE=1 SV=3 198 1e-50
sp|P27164|CALM3_PETHY Calmodulin-related protein OS=Petunia hybr... 198 1e-50
sp|P41040|CALM_MAIZE Calmodulin OS=Zea mays GN=CALM1 PE=2 SV=2 198 1e-50
sp|Q0JNL7|CALM3_ORYSJ Calmodulin-3 OS=Oryza sativa subsp. japoni... 197 2e-50
sp|P25854|CALM1_ARATH Calmodulin-1/4 OS=Arabidopsis thaliana GN=... 197 2e-50
sp|P48976|CALM_MALDO Calmodulin OS=Malus domestica GN=CAM PE=3 SV=2 196 4e-50
sp|O82018|CALM_MOUSC Calmodulin OS=Mougeotia scalaris PE=2 SV=3 196 7e-50
sp|P27161|CALM_SOLLC Calmodulin OS=Solanum lycopersicum GN=CALM1... 194 2e-49
sp|Q39752|CALM_FAGSY Calmodulin OS=Fagus sylvatica GN=CAMF1 PE=2... 193 5e-49

>sp|Q03509|CALM6_ARATH Calmodulin-6 OS=Arabidopsis thaliana GN=CAM6
PE=1 SV=2
Length = 149

Score = 201 bits (512), Expect = 1e-51
Identities = 100/105 (95%), Positives = 103/105 (98%)
Frame = -3

Query: 520 TEAELQDMINEVDADGNGTIDFAEFLNLMARKMKDTDSEEELKEAFRVFDKDQNGFISAA 341
TEAELQDMINEVDADGNGTIDF EFLNLMARKMKDTDSEEELKEAFRVFDKDQNGFISAA
Sbjct: 45 TEAELQDMINEVDADGNGTIDFPEFLNLMARKMKDTDSEEELKEAFRVFDKDQNGFISAA 104

Query: 340 ELRHVMTNLGEKLSDDEVDEMIREADVDGDGQINYEEFVKMMLGK 206
ELRHVMTNLGEKLSD+EVDEMIREADVDGDGQINYEEFVK+M+ K
Sbjct: 105 ELRHVMTNLGEKLSDEEVDEMIREADVDGDGQINYEEFVKVMMAK 149



Score = 65.9 bits (159), Expect = 1e-10
Identities = 34/77 (44%), Positives = 50/77 (64%)
Frame = -3

Query: 436 MARKMKDTDSEEELKEAFRVFDKDQNGFISAAELRHVMTNLGEKLSDDEVDEMIREADVD 257
MA ++ D D E KEAF +FDKD +G I+ EL VM +LG+ ++ E+ +MI E D D
Sbjct: 1 MADQLTD-DQISEFKEAFSLFDKDGDGCITTKELGTVMRSLGQNPTEAELQDMINEVDAD 59

Query: 256 GDGQINYEEFVKMMLGK 206
G+G I++ EF+ +M K
Sbjct: 60 GNGTIDFPEFLNLMARK 76


>sp|P04353|CALM_SPIOL Calmodulin OS=Spinacia oleracea PE=1 SV=2
Length = 149

Score = 200 bits (509), Expect = 3e-51
Identities = 99/105 (94%), Positives = 103/105 (98%)
Frame = -3

Query: 520 TEAELQDMINEVDADGNGTIDFAEFLNLMARKMKDTDSEEELKEAFRVFDKDQNGFISAA 341
TEAELQDMINEVDADGNGTIDF EFLNLMARKMKDTDSEEELKEAFRVFDKDQNGFISAA
Sbjct: 45 TEAELQDMINEVDADGNGTIDFPEFLNLMARKMKDTDSEEELKEAFRVFDKDQNGFISAA 104

Query: 340 ELRHVMTNLGEKLSDDEVDEMIREADVDGDGQINYEEFVKMMLGK 206
ELRHVMTNLGEKL+D+EVDEMIREADVDGDGQINYEEFVK+M+ K
Sbjct: 105 ELRHVMTNLGEKLTDEEVDEMIREADVDGDGQINYEEFVKVMMAK 149



Score = 64.7 bits (156), Expect = 3e-10
Identities = 33/77 (42%), Positives = 50/77 (64%)
Frame = -3

Query: 436 MARKMKDTDSEEELKEAFRVFDKDQNGFISAAELRHVMTNLGEKLSDDEVDEMIREADVD 257
MA ++ D + E KEAF +FDKD +G I+ EL VM +LG+ ++ E+ +MI E D D
Sbjct: 1 MAZZLTD-EQIAEFKEAFSLFDKDGDGCITTKELGTVMRSLGQNPTEAELQDMINEVDAD 59

Query: 256 GDGQINYEEFVKMMLGK 206
G+G I++ EF+ +M K
Sbjct: 60 GNGTIDFPEFLNLMARK 76


>sp|P17928|CALM_MEDSA Calmodulin OS=Medicago sativa GN=CAL1 PE=2
SV=2
Length = 149

Score = 200 bits (509), Expect = 3e-51
Identities = 99/105 (94%), Positives = 103/105 (98%)
Frame = -3

Query: 520 TEAELQDMINEVDADGNGTIDFAEFLNLMARKMKDTDSEEELKEAFRVFDKDQNGFISAA 341
TEAELQDMINEVDADGNGTIDF EFLNLMARKMKDTDSEEELKEAFRVFDKDQNGFISAA
Sbjct: 45 TEAELQDMINEVDADGNGTIDFPEFLNLMARKMKDTDSEEELKEAFRVFDKDQNGFISAA 104

Query: 340 ELRHVMTNLGEKLSDDEVDEMIREADVDGDGQINYEEFVKMMLGK 206
ELRHVMTNLGEKL+D+EVDEMIREADVDGDGQINYEEFVK+M+ K
Sbjct: 105 ELRHVMTNLGEKLTDEEVDEMIREADVDGDGQINYEEFVKVMMAK 149



Score = 64.3 bits (155), Expect = 3e-10
Identities = 33/77 (42%), Positives = 50/77 (64%)
Frame = -3

Query: 436 MARKMKDTDSEEELKEAFRVFDKDQNGFISAAELRHVMTNLGEKLSDDEVDEMIREADVD 257
MA ++ D + E KEAF +FDKD +G I+ EL VM +LG+ ++ E+ +MI E D D
Sbjct: 1 MADQLTD-EQISEFKEAFSLFDKDGDGCITTKELGTVMRSLGQNPTEAELQDMINEVDAD 59

Query: 256 GDGQINYEEFVKMMLGK 206
G+G I++ EF+ +M K
Sbjct: 60 GNGTIDFPEFLNLMARK 76


>sp|P62201|CALM_LILLO Calmodulin OS=Lilium longiflorum PE=2 SV=2
Length = 149

Score = 200 bits (509), Expect = 3e-51
Identities = 99/105 (94%), Positives = 103/105 (98%)
Frame = -3

Query: 520 TEAELQDMINEVDADGNGTIDFAEFLNLMARKMKDTDSEEELKEAFRVFDKDQNGFISAA 341
TEAELQDMINEVDADGNGTIDF EFLNLMARKMKDTDSEEELKEAFRVFDKDQNGFISAA
Sbjct: 45 TEAELQDMINEVDADGNGTIDFPEFLNLMARKMKDTDSEEELKEAFRVFDKDQNGFISAA 104

Query: 340 ELRHVMTNLGEKLSDDEVDEMIREADVDGDGQINYEEFVKMMLGK 206
ELRHVMTNLGEKL+D+EVDEMIREADVDGDGQINYEEFVK+M+ K
Sbjct: 105 ELRHVMTNLGEKLTDEEVDEMIREADVDGDGQINYEEFVKVMMAK 149



Score = 65.9 bits (159), Expect = 1e-10
Identities = 34/77 (44%), Positives = 50/77 (64%)
Frame = -3

Query: 436 MARKMKDTDSEEELKEAFRVFDKDQNGFISAAELRHVMTNLGEKLSDDEVDEMIREADVD 257
MA ++ D D E KEAF +FDKD +G I+ EL VM +LG+ ++ E+ +MI E D D
Sbjct: 1 MADQLTD-DQISEFKEAFSLFDKDGDGCITTKELGTVMRSLGQNPTEAELQDMINEVDAD 59

Query: 256 GDGQINYEEFVKMMLGK 206
G+G I++ EF+ +M K
Sbjct: 60 GNGTIDFPEFLNLMARK 76


>sp|P62162|CALM_HORVU Calmodulin OS=Hordeum vulgare GN=CAM PE=2 SV=2
Length = 149

Score = 200 bits (509), Expect = 3e-51
Identities = 99/105 (94%), Positives = 103/105 (98%)
Frame = -3

Query: 520 TEAELQDMINEVDADGNGTIDFAEFLNLMARKMKDTDSEEELKEAFRVFDKDQNGFISAA 341
TEAELQDMINEVDADGNGTIDF EFLNLMARKMKDTDSEEELKEAFRVFDKDQNGFISAA
Sbjct: 45 TEAELQDMINEVDADGNGTIDFPEFLNLMARKMKDTDSEEELKEAFRVFDKDQNGFISAA 104

Query: 340 ELRHVMTNLGEKLSDDEVDEMIREADVDGDGQINYEEFVKMMLGK 206
ELRHVMTNLGEKL+D+EVDEMIREADVDGDGQINYEEFVK+M+ K
Sbjct: 105 ELRHVMTNLGEKLTDEEVDEMIREADVDGDGQINYEEFVKVMMAK 149



Score = 65.5 bits (158), Expect = 1e-10
Identities = 34/77 (44%), Positives = 50/77 (64%)
Frame = -3

Query: 436 MARKMKDTDSEEELKEAFRVFDKDQNGFISAAELRHVMTNLGEKLSDDEVDEMIREADVD 257
MA ++ D D E KEAF +FDKD +G I+ EL VM +LG+ ++ E+ +MI E D D
Sbjct: 1 MADQLTD-DQIAEFKEAFSLFDKDGDGCITTKELGTVMRSLGQNPTEAELQDMINEVDAD 59

Query: 256 GDGQINYEEFVKMMLGK 206
G+G I++ EF+ +M K
Sbjct: 60 GNGTIDFPEFLNLMARK 76


>sp|P93171|CALM_HELAN Calmodulin OS=Helianthus annuus GN=CAM PE=2
SV=3
Length = 149

Score = 200 bits (509), Expect = 3e-51
Identities = 99/105 (94%), Positives = 103/105 (98%)
Frame = -3

Query: 520 TEAELQDMINEVDADGNGTIDFAEFLNLMARKMKDTDSEEELKEAFRVFDKDQNGFISAA 341
TEAELQDMINEVDADGNGTIDF EFLNLMARKMKDTDSEEELKEAFRVFDKDQNGFISAA
Sbjct: 45 TEAELQDMINEVDADGNGTIDFPEFLNLMARKMKDTDSEEELKEAFRVFDKDQNGFISAA 104

Query: 340 ELRHVMTNLGEKLSDDEVDEMIREADVDGDGQINYEEFVKMMLGK 206
ELRHVMTNLGEKL+D+EVDEMIREADVDGDGQINYEEFVK+M+ K
Sbjct: 105 ELRHVMTNLGEKLTDEEVDEMIREADVDGDGQINYEEFVKVMMAK 149



Score = 64.7 bits (156), Expect = 3e-10
Identities = 31/69 (44%), Positives = 45/69 (65%)
Frame = -3

Query: 412 DSEEELKEAFRVFDKDQNGFISAAELRHVMTNLGEKLSDDEVDEMIREADVDGDGQINYE 233
D E KEAF +FDKD +G I+ EL VM +LG+ ++ E+ +MI E D DG+G I++
Sbjct: 8 DQISEFKEAFSLFDKDGDGCITTKELGTVMRSLGQNPTEAELQDMINEVDADGNGTIDFP 67

Query: 232 EFVKMMLGK 206
EF+ +M K
Sbjct: 68 EFLNLMARK 76


>sp|Q7Y052|CALM_EUPCH Calmodulin OS=Euphorbia characias PE=2 SV=4
Length = 149

Score = 200 bits (509), Expect = 3e-51
Identities = 99/105 (94%), Positives = 103/105 (98%)
Frame = -3

Query: 520 TEAELQDMINEVDADGNGTIDFAEFLNLMARKMKDTDSEEELKEAFRVFDKDQNGFISAA 341
TEAELQDMINEVDADGNGTIDF EFLNLMARKMKDTDSEEELKEAFRVFDKDQNGFISAA
Sbjct: 45 TEAELQDMINEVDADGNGTIDFPEFLNLMARKMKDTDSEEELKEAFRVFDKDQNGFISAA 104

Query: 340 ELRHVMTNLGEKLSDDEVDEMIREADVDGDGQINYEEFVKMMLGK 206
ELRHVMTNLGEKL+D+EVDEMIREADVDGDGQINYEEFVK+M+ K
Sbjct: 105 ELRHVMTNLGEKLTDEEVDEMIREADVDGDGQINYEEFVKVMMAK 149



Score = 65.9 bits (159), Expect = 1e-10
Identities = 34/77 (44%), Positives = 50/77 (64%)
Frame = -3

Query: 436 MARKMKDTDSEEELKEAFRVFDKDQNGFISAAELRHVMTNLGEKLSDDEVDEMIREADVD 257
MA ++ D D E KEAF +FDKD +G I+ EL VM +LG+ ++ E+ +MI E D D
Sbjct: 1 MADQLTD-DQISEFKEAFSLFDKDGDGCITTKELGTVMRSLGQNPTEAELQDMINEVDAD 59

Query: 256 GDGQINYEEFVKMMLGK 206
G+G I++ EF+ +M K
Sbjct: 60 GNGTIDFPEFLNLMARK 76


>sp|P62202|CALM_BRYDI Calmodulin OS=Bryonia dioica PE=2 SV=2
Length = 149

Score = 200 bits (509), Expect = 3e-51
Identities = 99/105 (94%), Positives = 103/105 (98%)
Frame = -3

Query: 520 TEAELQDMINEVDADGNGTIDFAEFLNLMARKMKDTDSEEELKEAFRVFDKDQNGFISAA 341
TEAELQDMINEVDADGNGTIDF EFLNLMARKMKDTDSEEELKEAFRVFDKDQNGFISAA
Sbjct: 45 TEAELQDMINEVDADGNGTIDFPEFLNLMARKMKDTDSEEELKEAFRVFDKDQNGFISAA 104

Query: 340 ELRHVMTNLGEKLSDDEVDEMIREADVDGDGQINYEEFVKMMLGK 206
ELRHVMTNLGEKL+D+EVDEMIREADVDGDGQINYEEFVK+M+ K
Sbjct: 105 ELRHVMTNLGEKLTDEEVDEMIREADVDGDGQINYEEFVKVMMAK 149



Score = 65.9 bits (159), Expect = 1e-10
Identities = 34/77 (44%), Positives = 50/77 (64%)
Frame = -3

Query: 436 MARKMKDTDSEEELKEAFRVFDKDQNGFISAAELRHVMTNLGEKLSDDEVDEMIREADVD 257
MA ++ D D E KEAF +FDKD +G I+ EL VM +LG+ ++ E+ +MI E D D
Sbjct: 1 MADQLTD-DQISEFKEAFSLFDKDGDGCITTKELGTVMRSLGQNPTEAELQDMINEVDAD 59

Query: 256 GDGQINYEEFVKMMLGK 206
G+G I++ EF+ +M K
Sbjct: 60 GNGTIDFPEFLNLMARK 76


>sp|P59220|CALM7_ARATH Calmodulin-7 OS=Arabidopsis thaliana GN=CAM7
PE=1 SV=2
Length = 149

Score = 200 bits (509), Expect = 3e-51
Identities = 99/105 (94%), Positives = 103/105 (98%)
Frame = -3

Query: 520 TEAELQDMINEVDADGNGTIDFAEFLNLMARKMKDTDSEEELKEAFRVFDKDQNGFISAA 341
TEAELQDMINEVDADGNGTIDF EFLNLMARKMKDTDSEEELKEAFRVFDKDQNGFISAA
Sbjct: 45 TEAELQDMINEVDADGNGTIDFPEFLNLMARKMKDTDSEEELKEAFRVFDKDQNGFISAA 104

Query: 340 ELRHVMTNLGEKLSDDEVDEMIREADVDGDGQINYEEFVKMMLGK 206
ELRHVMTNLGEKL+D+EVDEMIREADVDGDGQINYEEFVK+M+ K
Sbjct: 105 ELRHVMTNLGEKLTDEEVDEMIREADVDGDGQINYEEFVKVMMAK 149



Score = 65.9 bits (159), Expect = 1e-10
Identities = 34/77 (44%), Positives = 50/77 (64%)
Frame = -3

Query: 436 MARKMKDTDSEEELKEAFRVFDKDQNGFISAAELRHVMTNLGEKLSDDEVDEMIREADVD 257
MA ++ D D E KEAF +FDKD +G I+ EL VM +LG+ ++ E+ +MI E D D
Sbjct: 1 MADQLTD-DQISEFKEAFSLFDKDGDGCITTKELGTVMRSLGQNPTEAELQDMINEVDAD 59

Query: 256 GDGQINYEEFVKMMLGK 206
G+G I++ EF+ +M K
Sbjct: 60 GNGTIDFPEFLNLMARK 76


>sp|P62163|CALM2_SOYBN Calmodulin-2 OS=Glycine max GN=CAM-2 PE=1
SV=2
Length = 149

Score = 200 bits (509), Expect = 3e-51
Identities = 99/105 (94%), Positives = 103/105 (98%)
Frame = -3

Query: 520 TEAELQDMINEVDADGNGTIDFAEFLNLMARKMKDTDSEEELKEAFRVFDKDQNGFISAA 341
TEAELQDMINEVDADGNGTIDF EFLNLMARKMKDTDSEEELKEAFRVFDKDQNGFISAA
Sbjct: 45 TEAELQDMINEVDADGNGTIDFPEFLNLMARKMKDTDSEEELKEAFRVFDKDQNGFISAA 104

Query: 340 ELRHVMTNLGEKLSDDEVDEMIREADVDGDGQINYEEFVKMMLGK 206
ELRHVMTNLGEKL+D+EVDEMIREADVDGDGQINYEEFVK+M+ K
Sbjct: 105 ELRHVMTNLGEKLTDEEVDEMIREADVDGDGQINYEEFVKVMMAK 149



Score = 65.5 bits (158), Expect = 1e-10
Identities = 34/77 (44%), Positives = 50/77 (64%)
Frame = -3

Query: 436 MARKMKDTDSEEELKEAFRVFDKDQNGFISAAELRHVMTNLGEKLSDDEVDEMIREADVD 257
MA ++ D D E KEAF +FDKD +G I+ EL VM +LG+ ++ E+ +MI E D D
Sbjct: 1 MADQLTD-DQIAEFKEAFSLFDKDGDGCITTKELGTVMRSLGQNPTEAELQDMINEVDAD 59

Query: 256 GDGQINYEEFVKMMLGK 206
G+G I++ EF+ +M K
Sbjct: 60 GNGTIDFPEFLNLMARK 76


tr_hit_id A9S0X7
Definition tr|A9S0X7|A9S0X7_PHYPA Predicted protein OS=Physcomitrella patens subsp. patens
Align length 105
Score (bit) 205.0
E-value 1.0e-51
Report
BLASTX 2.2.19 [Nov-02-2008]


Reference: Altschul, Stephen F., Thomas L. Madden, Alejandro A. Schaffer,
Jinghui Zhang, Zheng Zhang, Webb Miller, and David J. Lipman (1997),
"Gapped BLAST and PSI-BLAST: a new generation of protein database search
programs", Nucleic Acids Res. 25:3389-3402.

Query= BP918231|Adiantum capillus-veneris mRNA, clone:
YMU001_000111_A09.
(522 letters)

Database: uniprot_trembl.fasta
7,341,751 sequences; 2,391,615,440 total letters

Searching..................................................done



Score E
Sequences producing significant alignments: (bits) Value

tr|A9S0X7|A9S0X7_PHYPA Predicted protein OS=Physcomitrella paten... 205 1e-51
tr|A9RWJ4|A9RWJ4_PHYPA Predicted protein OS=Physcomitrella paten... 205 1e-51
tr|Q5CC36|Q5CC36_QUEPE Calmodulin OS=Quercus petraea GN=caM-3 PE... 202 1e-50
tr|A9RNC0|A9RNC0_PHYPA Predicted protein OS=Physcomitrella paten... 202 1e-50
tr|A9NPT3|A9NPT3_PICSI Putative uncharacterized protein OS=Picea... 201 2e-50
tr|Q93VL8|Q93VL8_PHAVU Calmodulin OS=Phaseolus vulgaris GN=CaM P... 200 3e-50
tr|Q7DMZ3|Q7DMZ3_9FABA Calmodulin (Auxin-regulated calmodulin) O... 200 3e-50
tr|Q7DMG9|Q7DMG9_WHEAT Calmodulin TaCaM1-1 (Calmodulin TaCaM4-1)... 200 3e-50
tr|Q7DLT8|Q7DLT8_CICAR CaM protein OS=Cicer arietinum GN=CaM PE=... 200 3e-50
tr|Q7DLR7|Q7DLR7_MAIZE Putative uncharacterized protein OS=Zea m... 200 3e-50
tr|Q76MF3|Q76MF3_TOBAC Calmodulin NtCaM3 (Calmodulin NtCaM12) (C... 200 3e-50
tr|Q71V71|Q71V71_PHAVU Calmodulin OS=Phaseolus vulgaris GN=CaM P... 200 3e-50
tr|Q71SN1|Q71SN1_PRUAV Calmodulin OS=Prunus avium PE=2 SV=1 200 3e-50
tr|Q71SM1|Q71SM1_ELAGV Calmodulin OS=Elaeis guineensis var. tene... 200 3e-50
tr|Q71JC6|Q71JC6_MEDTR Calmodulin 1 OS=Medicago truncatula PE=2 ... 200 3e-50
tr|Q71JC5|Q71JC5_MEDTR Putative uncharacterized protein OS=Medic... 200 3e-50
tr|Q6UQE4|Q6UQE4_DAUCA Calmodulin 8 (Calmodulin 4) (Fragment) OS... 200 3e-50
tr|Q6LEG8|Q6LEG8_SOYBN Calmodulin OS=Glycine max GN=SCaM-1 PE=2 ... 200 3e-50
tr|Q6LEC4|Q6LEC4_9FABA Calmodulin OS=Vigna radiata PE=2 SV=1 200 3e-50
tr|Q6LCY3|Q6LCY3_PEA Calmodulin OS=Pisum sativum PE=2 SV=1 200 3e-50
tr|Q6LBM2|Q6LBM2_MALDO Calmodulin OS=Malus domestica GN=CaM PE=2... 200 3e-50
tr|Q6DN34|Q6DN34_DAUCA Calmodulin cam-202 (Calmodulin cam-209) (... 200 3e-50
tr|Q6DN31|Q6DN31_DAUCA Calmodulin cam-205 OS=Daucus carota PE=2 ... 200 3e-50
tr|Q6DN29|Q6DN29_DAUCA Caomodulin cam-207 OS=Daucus carota PE=2 ... 200 3e-50
tr|Q5ZFS9|Q5ZFS9_PLAMJ Calmodulin OS=Plantago major GN=cam1 PE=2... 200 3e-50
tr|Q5CC37|Q5CC37_QUEPE Calmodulin OS=Quercus petraea GN=caM-2 PE... 200 3e-50
tr|Q3LRX1|Q3LRX1_CATRO Calmodulin 2 OS=Catharanthus roseus PE=2 ... 200 3e-50
tr|Q1H5F3|Q1H5F3_ARATH At3g43810 (Calmodulin 7) OS=Arabidopsis t... 200 3e-50
tr|O82773|O82773_NICPL CaM-2 (CaM-1) (Fragment) OS=Nicotiana plu... 200 3e-50
tr|B8AC80|B8AC80_ORYSI Putative uncharacterized protein OS=Oryza... 200 3e-50

>tr|A9S0X7|A9S0X7_PHYPA Predicted protein OS=Physcomitrella patens
subsp. patens GN=PHYPADRAFT_180168 PE=4 SV=1
Length = 149

Score = 205 bits (522), Expect = 1e-51
Identities = 102/105 (97%), Positives = 104/105 (99%)
Frame = -3

Query: 520 TEAELQDMINEVDADGNGTIDFAEFLNLMARKMKDTDSEEELKEAFRVFDKDQNGFISAA 341
TEAELQDMINEVDADGNGTIDFAEFLNLMARKMKDTDSEEELKEAFRVFDKDQNGFISAA
Sbjct: 45 TEAELQDMINEVDADGNGTIDFAEFLNLMARKMKDTDSEEELKEAFRVFDKDQNGFISAA 104

Query: 340 ELRHVMTNLGEKLSDDEVDEMIREADVDGDGQINYEEFVKMMLGK 206
ELRHVMTNLGEKL+DDEVDEMIREADVDGDGQINYEEFVKMM+ K
Sbjct: 105 ELRHVMTNLGEKLTDDEVDEMIREADVDGDGQINYEEFVKMMMAK 149



Score = 64.3 bits (155), Expect = 3e-09
Identities = 31/69 (44%), Positives = 45/69 (65%)
Frame = -3

Query: 412 DSEEELKEAFRVFDKDQNGFISAAELRHVMTNLGEKLSDDEVDEMIREADVDGDGQINYE 233
D E KEAF +FDKD +G I+ EL VM +LG+ ++ E+ +MI E D DG+G I++
Sbjct: 8 DQIAEFKEAFSLFDKDGDGSITTKELGTVMRSLGQNPTEAELQDMINEVDADGNGTIDFA 67

Query: 232 EFVKMMLGK 206
EF+ +M K
Sbjct: 68 EFLNLMARK 76


>tr|A9RWJ4|A9RWJ4_PHYPA Predicted protein OS=Physcomitrella patens
subsp. patens GN=PHYPADRAFT_161424 PE=4 SV=1
Length = 149

Score = 205 bits (522), Expect = 1e-51
Identities = 102/105 (97%), Positives = 104/105 (99%)
Frame = -3

Query: 520 TEAELQDMINEVDADGNGTIDFAEFLNLMARKMKDTDSEEELKEAFRVFDKDQNGFISAA 341
TEAELQDMINEVDADGNGTIDFAEFLNLMARKMKDTDSEEELKEAFRVFDKDQNGFISAA
Sbjct: 45 TEAELQDMINEVDADGNGTIDFAEFLNLMARKMKDTDSEEELKEAFRVFDKDQNGFISAA 104

Query: 340 ELRHVMTNLGEKLSDDEVDEMIREADVDGDGQINYEEFVKMMLGK 206
ELRHVMTNLGEKL+DDEVDEMIREADVDGDGQINYEEFVKMM+ K
Sbjct: 105 ELRHVMTNLGEKLTDDEVDEMIREADVDGDGQINYEEFVKMMMAK 149



Score = 63.5 bits (153), Expect = 6e-09
Identities = 30/65 (46%), Positives = 44/65 (67%)
Frame = -3

Query: 400 ELKEAFRVFDKDQNGFISAAELRHVMTNLGEKLSDDEVDEMIREADVDGDGQINYEEFVK 221
E KEAF +FDKD +G I+ EL VM +LG+ ++ E+ +MI E D DG+G I++ EF+
Sbjct: 12 EFKEAFSLFDKDGDGSITTKELGTVMRSLGQNPTEAELQDMINEVDADGNGTIDFAEFLN 71

Query: 220 MMLGK 206
+M K
Sbjct: 72 LMARK 76


>tr|Q5CC36|Q5CC36_QUEPE Calmodulin OS=Quercus petraea GN=caM-3 PE=2
SV=1
Length = 149

Score = 202 bits (513), Expect = 1e-50
Identities = 100/105 (95%), Positives = 103/105 (98%)
Frame = -3

Query: 520 TEAELQDMINEVDADGNGTIDFAEFLNLMARKMKDTDSEEELKEAFRVFDKDQNGFISAA 341
TEAELQDMINEVDADGNGTIDF EFLNLMARKMKDTDSEEELKEAFRVFDKDQNGFISAA
Sbjct: 45 TEAELQDMINEVDADGNGTIDFPEFLNLMARKMKDTDSEEELKEAFRVFDKDQNGFISAA 104

Query: 340 ELRHVMTNLGEKLSDDEVDEMIREADVDGDGQINYEEFVKMMLGK 206
ELRHVMTNLGEKL+DDEVDEMIREADVDGDGQINYEEFVK+M+ K
Sbjct: 105 ELRHVMTNLGEKLTDDEVDEMIREADVDGDGQINYEEFVKVMMAK 149



Score = 65.9 bits (159), Expect = 1e-09
Identities = 34/77 (44%), Positives = 50/77 (64%)
Frame = -3

Query: 436 MARKMKDTDSEEELKEAFRVFDKDQNGFISAAELRHVMTNLGEKLSDDEVDEMIREADVD 257
MA ++ D D E KEAF +FDKD +G I+ EL VM +LG+ ++ E+ +MI E D D
Sbjct: 1 MADQLTD-DQISEFKEAFSLFDKDGDGCITTKELGTVMRSLGQNPTEAELQDMINEVDAD 59

Query: 256 GDGQINYEEFVKMMLGK 206
G+G I++ EF+ +M K
Sbjct: 60 GNGTIDFPEFLNLMARK 76


>tr|A9RNC0|A9RNC0_PHYPA Predicted protein OS=Physcomitrella patens
subsp. patens GN=PHYPADRAFT_116985 PE=4 SV=1
Length = 149

Score = 202 bits (513), Expect = 1e-50
Identities = 100/105 (95%), Positives = 104/105 (99%)
Frame = -3

Query: 520 TEAELQDMINEVDADGNGTIDFAEFLNLMARKMKDTDSEEELKEAFRVFDKDQNGFISAA 341
TEAELQDMI+EVDADGNGTIDFAEFLNLMARKMKD+DSEEELKEAFRVFDKDQNGFISAA
Sbjct: 45 TEAELQDMISEVDADGNGTIDFAEFLNLMARKMKDSDSEEELKEAFRVFDKDQNGFISAA 104

Query: 340 ELRHVMTNLGEKLSDDEVDEMIREADVDGDGQINYEEFVKMMLGK 206
ELRHVMTNLGEKL+DDEVDEMIREADVDGDGQINYEEFVKMM+ K
Sbjct: 105 ELRHVMTNLGEKLTDDEVDEMIREADVDGDGQINYEEFVKMMMAK 149



Score = 63.9 bits (154), Expect = 4e-09
Identities = 31/69 (44%), Positives = 45/69 (65%)
Frame = -3

Query: 412 DSEEELKEAFRVFDKDQNGFISAAELRHVMTNLGEKLSDDEVDEMIREADVDGDGQINYE 233
D E KEAF +FDKD +G I+ EL VM +LG+ ++ E+ +MI E D DG+G I++
Sbjct: 8 DQIAEFKEAFSLFDKDGDGSITTKELGTVMRSLGQNPTEAELQDMISEVDADGNGTIDFA 67

Query: 232 EFVKMMLGK 206
EF+ +M K
Sbjct: 68 EFLNLMARK 76


>tr|A9NPT3|A9NPT3_PICSI Putative uncharacterized protein OS=Picea
sitchensis PE=2 SV=1
Length = 149

Score = 201 bits (510), Expect = 2e-50
Identities = 99/105 (94%), Positives = 104/105 (99%)
Frame = -3

Query: 520 TEAELQDMINEVDADGNGTIDFAEFLNLMARKMKDTDSEEELKEAFRVFDKDQNGFISAA 341
TEAELQDMINEVDADGNGTIDFAEFLNLMARK+KDTDSEEELKEAFRVFDKDQNGFISAA
Sbjct: 45 TEAELQDMINEVDADGNGTIDFAEFLNLMARKVKDTDSEEELKEAFRVFDKDQNGFISAA 104

Query: 340 ELRHVMTNLGEKLSDDEVDEMIREADVDGDGQINYEEFVKMMLGK 206
ELRHVMTNLGEKL+D+EVDEMIREADVDGDGQINYEEFVK+M+ K
Sbjct: 105 ELRHVMTNLGEKLTDEEVDEMIREADVDGDGQINYEEFVKVMMAK 149



Score = 64.3 bits (155), Expect = 3e-09
Identities = 34/76 (44%), Positives = 49/76 (64%), Gaps = 3/76 (3%)
Frame = -3

Query: 424 MKDTDSEE---ELKEAFRVFDKDQNGFISAAELRHVMTNLGEKLSDDEVDEMIREADVDG 254
M D +EE E KEAF +FDKD +G I+ EL VM +LG+ ++ E+ +MI E D DG
Sbjct: 1 MMDKLTEEQISEFKEAFSLFDKDGDGCITTKELGTVMRSLGQNPTEAELQDMINEVDADG 60

Query: 253 DGQINYEEFVKMMLGK 206
+G I++ EF+ +M K
Sbjct: 61 NGTIDFAEFLNLMARK 76


>tr|Q93VL8|Q93VL8_PHAVU Calmodulin OS=Phaseolus vulgaris GN=CaM PE=2
SV=1
Length = 149

Score = 200 bits (509), Expect = 3e-50
Identities = 99/105 (94%), Positives = 103/105 (98%)
Frame = -3

Query: 520 TEAELQDMINEVDADGNGTIDFAEFLNLMARKMKDTDSEEELKEAFRVFDKDQNGFISAA 341
TEAELQDMINEVDADGNGTIDF EFLNLMARKMKDTDSEEELKEAFRVFDKDQNGFISAA
Sbjct: 45 TEAELQDMINEVDADGNGTIDFPEFLNLMARKMKDTDSEEELKEAFRVFDKDQNGFISAA 104

Query: 340 ELRHVMTNLGEKLSDDEVDEMIREADVDGDGQINYEEFVKMMLGK 206
ELRHVMTNLGEKL+D+EVDEMIREADVDGDGQINYEEFVK+M+ K
Sbjct: 105 ELRHVMTNLGEKLTDEEVDEMIREADVDGDGQINYEEFVKVMMAK 149



Score = 63.9 bits (154), Expect = 4e-09
Identities = 33/77 (42%), Positives = 50/77 (64%)
Frame = -3

Query: 436 MARKMKDTDSEEELKEAFRVFDKDQNGFISAAELRHVMTNLGEKLSDDEVDEMIREADVD 257
MA ++ D + E KEAF +FDKD +G I+ EL VM +LG+ ++ E+ +MI E D D
Sbjct: 1 MADQLTD-EQIAEFKEAFSLFDKDGDGCITTKELGTVMRSLGQNPTEAELQDMINEVDAD 59

Query: 256 GDGQINYEEFVKMMLGK 206
G+G I++ EF+ +M K
Sbjct: 60 GNGTIDFPEFLNLMARK 76


>tr|Q7DMZ3|Q7DMZ3_9FABA Calmodulin (Auxin-regulated calmodulin)
OS=Vigna radiata PE=2 SV=1
Length = 149

Score = 200 bits (509), Expect = 3e-50
Identities = 99/105 (94%), Positives = 103/105 (98%)
Frame = -3

Query: 520 TEAELQDMINEVDADGNGTIDFAEFLNLMARKMKDTDSEEELKEAFRVFDKDQNGFISAA 341
TEAELQDMINEVDADGNGTIDF EFLNLMARKMKDTDSEEELKEAFRVFDKDQNGFISAA
Sbjct: 45 TEAELQDMINEVDADGNGTIDFPEFLNLMARKMKDTDSEEELKEAFRVFDKDQNGFISAA 104

Query: 340 ELRHVMTNLGEKLSDDEVDEMIREADVDGDGQINYEEFVKMMLGK 206
ELRHVMTNLGEKL+D+EVDEMIREADVDGDGQINYEEFVK+M+ K
Sbjct: 105 ELRHVMTNLGEKLTDEEVDEMIREADVDGDGQINYEEFVKVMMAK 149



Score = 65.5 bits (158), Expect = 2e-09
Identities = 34/77 (44%), Positives = 50/77 (64%)
Frame = -3

Query: 436 MARKMKDTDSEEELKEAFRVFDKDQNGFISAAELRHVMTNLGEKLSDDEVDEMIREADVD 257
MA ++ D D E KEAF +FDKD +G I+ EL VM +LG+ ++ E+ +MI E D D
Sbjct: 1 MADQLTD-DQIAEFKEAFSLFDKDGDGCITTKELGTVMRSLGQNPTEAELQDMINEVDAD 59

Query: 256 GDGQINYEEFVKMMLGK 206
G+G I++ EF+ +M K
Sbjct: 60 GNGTIDFPEFLNLMARK 76


>tr|Q7DMG9|Q7DMG9_WHEAT Calmodulin TaCaM1-1 (Calmodulin TaCaM4-1)
(Calmodulin TaCaM3-3) (Calmodulin TaCaM3-2) (Calmodulin
TaCaM3-1) (Calmodulin TaCaM1-3) (Calmodulin TaCaM1-2)
OS=Triticum aestivum PE=2 SV=1
Length = 149

Score = 200 bits (509), Expect = 3e-50
Identities = 99/105 (94%), Positives = 103/105 (98%)
Frame = -3

Query: 520 TEAELQDMINEVDADGNGTIDFAEFLNLMARKMKDTDSEEELKEAFRVFDKDQNGFISAA 341
TEAELQDMINEVDADGNGTIDF EFLNLMARKMKDTDSEEELKEAFRVFDKDQNGFISAA
Sbjct: 45 TEAELQDMINEVDADGNGTIDFPEFLNLMARKMKDTDSEEELKEAFRVFDKDQNGFISAA 104

Query: 340 ELRHVMTNLGEKLSDDEVDEMIREADVDGDGQINYEEFVKMMLGK 206
ELRHVMTNLGEKL+D+EVDEMIREADVDGDGQINYEEFVK+M+ K
Sbjct: 105 ELRHVMTNLGEKLTDEEVDEMIREADVDGDGQINYEEFVKVMMAK 149



Score = 65.5 bits (158), Expect = 2e-09
Identities = 34/77 (44%), Positives = 50/77 (64%)
Frame = -3

Query: 436 MARKMKDTDSEEELKEAFRVFDKDQNGFISAAELRHVMTNLGEKLSDDEVDEMIREADVD 257
MA ++ D D E KEAF +FDKD +G I+ EL VM +LG+ ++ E+ +MI E D D
Sbjct: 1 MADQLTD-DQIAEFKEAFSLFDKDGDGCITTKELGTVMRSLGQNPTEAELQDMINEVDAD 59

Query: 256 GDGQINYEEFVKMMLGK 206
G+G I++ EF+ +M K
Sbjct: 60 GNGTIDFPEFLNLMARK 76


>tr|Q7DLT8|Q7DLT8_CICAR CaM protein OS=Cicer arietinum GN=CaM PE=2
SV=1
Length = 149

Score = 200 bits (509), Expect = 3e-50
Identities = 99/105 (94%), Positives = 103/105 (98%)
Frame = -3

Query: 520 TEAELQDMINEVDADGNGTIDFAEFLNLMARKMKDTDSEEELKEAFRVFDKDQNGFISAA 341
TEAELQDMINEVDADGNGTIDF EFLNLMARKMKDTDSEEELKEAFRVFDKDQNGFISAA
Sbjct: 45 TEAELQDMINEVDADGNGTIDFPEFLNLMARKMKDTDSEEELKEAFRVFDKDQNGFISAA 104

Query: 340 ELRHVMTNLGEKLSDDEVDEMIREADVDGDGQINYEEFVKMMLGK 206
ELRHVMTNLGEKL+D+EVDEMIREADVDGDGQINYEEFVK+M+ K
Sbjct: 105 ELRHVMTNLGEKLTDEEVDEMIREADVDGDGQINYEEFVKVMMAK 149



Score = 65.5 bits (158), Expect = 2e-09
Identities = 34/77 (44%), Positives = 50/77 (64%)
Frame = -3

Query: 436 MARKMKDTDSEEELKEAFRVFDKDQNGFISAAELRHVMTNLGEKLSDDEVDEMIREADVD 257
MA ++ D D E KEAF +FDKD +G I+ EL VM +LG+ ++ E+ +MI E D D
Sbjct: 1 MADQLTD-DQIAEFKEAFSLFDKDGDGCITTKELGTVMRSLGQNPTEAELQDMINEVDAD 59

Query: 256 GDGQINYEEFVKMMLGK 206
G+G I++ EF+ +M K
Sbjct: 60 GNGTIDFPEFLNLMARK 76


>tr|Q7DLR7|Q7DLR7_MAIZE Putative uncharacterized protein OS=Zea mays
PE=2 SV=1
Length = 149

Score = 200 bits (509), Expect = 3e-50
Identities = 99/105 (94%), Positives = 103/105 (98%)
Frame = -3

Query: 520 TEAELQDMINEVDADGNGTIDFAEFLNLMARKMKDTDSEEELKEAFRVFDKDQNGFISAA 341
TEAELQDMINEVDADGNGTIDF EFLNLMARKMKDTDSEEELKEAFRVFDKDQNGFISAA
Sbjct: 45 TEAELQDMINEVDADGNGTIDFPEFLNLMARKMKDTDSEEELKEAFRVFDKDQNGFISAA 104

Query: 340 ELRHVMTNLGEKLSDDEVDEMIREADVDGDGQINYEEFVKMMLGK 206
ELRHVMTNLGEKL+D+EVDEMIREADVDGDGQINYEEFVK+M+ K
Sbjct: 105 ELRHVMTNLGEKLTDEEVDEMIREADVDGDGQINYEEFVKVMMAK 149



Score = 63.9 bits (154), Expect = 4e-09
Identities = 33/77 (42%), Positives = 50/77 (64%)
Frame = -3

Query: 436 MARKMKDTDSEEELKEAFRVFDKDQNGFISAAELRHVMTNLGEKLSDDEVDEMIREADVD 257
MA ++ D + E KEAF +FDKD +G I+ EL VM +LG+ ++ E+ +MI E D D
Sbjct: 1 MADQLTD-EQIAEFKEAFSLFDKDGDGCITTKELGTVMRSLGQNPTEAELQDMINEVDAD 59

Query: 256 GDGQINYEEFVKMMLGK 206
G+G I++ EF+ +M K
Sbjct: 60 GNGTIDFPEFLNLMARK 76