BP918234
Clone id YMU001_000111_A12
Library
Length 537
Definition Adiantum capillus-veneris mRNA. clone: YMU001_000111_A12.
Accession
Tissue type prothallium
Developmental stage -
Contig ID -
Sequence
CAAGGACCTGACAGTACAGACTCCGCACACTTTGCCACGGTAAACAAGAATATGTATGCC
CGGGGGGAGCATCATAAAGGATTGCCACAAAGGGTCGAGGTAGTGACTGCAGCGTTGAGT
ATCTTGTCAGATTTTGAGGATGTTTATAGGCTGTGGGTTTTTGTTGCAAAATTTCTTGAT
GCTGATTTTGTCTCCAAAGAGCTTGGTGGACAGCCATTACATGTAGGAGCTGCCACCACT
TGACAGCCATGTCTTGACAGCTTGATTGTGTGGCATGTGCATAGGCTGTGATTAATGTTG
CAAAGTTTCTTGATGCAGTGTTAGTTGTCAAAGAGCTTGGTGGGCAGCCAACGCATGTGA
AACATGCCACCACTTGAGAGCTTGATGGTGCTACAGGGTTATGGCGTACTACGACATTTT
AAAGGGTACAAAGCAAAGTTGACCTTGATTCACTCATCAGGATTGCTTGTCCCTCTTTAC
ATTGATTCTTGAATCTCATCCAGTGCATGCAATTGTGAAATTTGCATTTGTATAGTG
■■Homology search results ■■ -
sp_hit_id Q0IIL2
Definition sp|Q0IIL2|CLD12_BOVIN Claudin-12 OS=Bos taurus
Align length 26
Score (bit) 30.4
E-value 5.7
Report
BLASTX 2.2.19 [Nov-02-2008]


Reference: Altschul, Stephen F., Thomas L. Madden, Alejandro A. Schaffer,
Jinghui Zhang, Zheng Zhang, Webb Miller, and David J. Lipman (1997),
"Gapped BLAST and PSI-BLAST: a new generation of protein database search
programs", Nucleic Acids Res. 25:3389-3402.

Query= BP918234|Adiantum capillus-veneris mRNA, clone:
YMU001_000111_A12.
(537 letters)

Database: uniprot_sprot.fasta
412,525 sequences; 148,809,765 total letters

Searching..................................................done



Score E
Sequences producing significant alignments: (bits) Value

sp|Q0IIL2|CLD12_BOVIN Claudin-12 OS=Bos taurus GN=CLDN12 PE=2 SV=1 30 5.7
sp|Q3SYZ6|XYLB_BOVIN Xylulose kinase OS=Bos taurus GN=XYLB PE=2 ... 30 7.4
sp|Q5R9K1|CLD12_PONAB Claudin-12 OS=Pongo abelii GN=CLDN12 PE=2 ... 30 7.4
sp|P56749|CLD12_HUMAN Claudin-12 OS=Homo sapiens GN=CLDN12 PE=2 ... 30 7.4
sp|Q63475|PTPR2_RAT Receptor-type tyrosine-protein phosphatase N... 30 9.7

>sp|Q0IIL2|CLD12_BOVIN Claudin-12 OS=Bos taurus GN=CLDN12 PE=2 SV=1
Length = 244

Score = 30.4 bits (67), Expect = 5.7
Identities = 15/26 (57%), Positives = 16/26 (61%), Gaps = 1/26 (3%)
Frame = -3

Query: 121 YSTLQSLPRPFVAILYDAPPG-HTYS 47
Y +SLP PF LY PPG HTYS
Sbjct: 196 YCACKSLPSPFWQPLYSHPPGMHTYS 221


>sp|Q3SYZ6|XYLB_BOVIN Xylulose kinase OS=Bos taurus GN=XYLB PE=2
SV=1
Length = 490

Score = 30.0 bits (66), Expect = 7.4
Identities = 28/103 (27%), Positives = 45/103 (43%), Gaps = 2/103 (1%)
Frame = -3

Query: 415 VVVRHNPVAPSSSQVVACFTCVGCPPSSLTTNTASRNFATLITAYAHATQSSCQDMAVKW 236
V+ +P P Q+ ACF+ CP + ++TA+ Q + AV
Sbjct: 111 VLTSLSPDLPLREQLQACFSISNCPVW-MDSSTAA--------------QCRQLEAAVGG 155

Query: 235 WQLLHVMAVHQALWR--QNQHQEILQQKPTAYKHPQNLTRYST 113
Q L ++ +A R NQ +I QQ P AY H + ++ S+
Sbjct: 156 AQALSLLTGSRAYERFTGNQIAKIYQQNPEAYSHTERISLVSS 198


>sp|Q5R9K1|CLD12_PONAB Claudin-12 OS=Pongo abelii GN=CLDN12 PE=2
SV=1
Length = 244

Score = 30.0 bits (66), Expect = 7.4
Identities = 15/26 (57%), Positives = 16/26 (61%), Gaps = 1/26 (3%)
Frame = -3

Query: 121 YSTLQSLPRPFVAILYDAPPG-HTYS 47
Y T +SLP PF LY PP HTYS
Sbjct: 196 YCTCKSLPSPFWQPLYSHPPSMHTYS 221


>sp|P56749|CLD12_HUMAN Claudin-12 OS=Homo sapiens GN=CLDN12 PE=2
SV=1
Length = 244

Score = 30.0 bits (66), Expect = 7.4
Identities = 15/26 (57%), Positives = 16/26 (61%), Gaps = 1/26 (3%)
Frame = -3

Query: 121 YSTLQSLPRPFVAILYDAPPG-HTYS 47
Y T +SLP PF LY PP HTYS
Sbjct: 196 YCTCKSLPSPFWQPLYSHPPSMHTYS 221


>sp|Q63475|PTPR2_RAT Receptor-type tyrosine-protein phosphatase N2
OS=Rattus norvegicus GN=Ptprn2 PE=2 SV=1
Length = 1004

Score = 29.6 bits (65), Expect = 9.7
Identities = 14/36 (38%), Positives = 21/36 (58%)
Frame = -3

Query: 241 KWWQLLHVMAVHQALWRQNQHQEILQQKPTAYKHPQ 134
KW+ L +A+ + L R + E+L Q PTA HP+
Sbjct: 136 KWFSLESEVALAKTLRRYLPYLELLSQAPTANAHPR 171


tr_hit_id A9RG94
Definition tr|A9RG94|A9RG94_PHYPA Predicted protein OS=Physcomitrella patens subsp. patens
Align length 39
Score (bit) 61.6
E-value 2.0e-08
Report
BLASTX 2.2.19 [Nov-02-2008]


Reference: Altschul, Stephen F., Thomas L. Madden, Alejandro A. Schaffer,
Jinghui Zhang, Zheng Zhang, Webb Miller, and David J. Lipman (1997),
"Gapped BLAST and PSI-BLAST: a new generation of protein database search
programs", Nucleic Acids Res. 25:3389-3402.

Query= BP918234|Adiantum capillus-veneris mRNA, clone:
YMU001_000111_A12.
(537 letters)

Database: uniprot_trembl.fasta
7,341,751 sequences; 2,391,615,440 total letters

Searching..................................................done



Score E
Sequences producing significant alignments: (bits) Value

tr|A9RG94|A9RG94_PHYPA Predicted protein OS=Physcomitrella paten... 62 2e-08
tr|A9TR75|A9TR75_PHYPA Predicted protein OS=Physcomitrella paten... 60 7e-08
tr|A9U2B6|A9U2B6_PHYPA Predicted protein OS=Physcomitrella paten... 59 1e-07
tr|A7R1T5|A7R1T5_VITVI Chromosome undetermined scaffold_376, who... 59 2e-07
tr|Q9FGL6|Q9FGL6_ARATH Genomic DNA, chromosome 5, P1 clone:MJM18... 59 2e-07
tr|B8A1Q9|B8A1Q9_MAIZE Putative uncharacterized protein OS=Zea m... 57 8e-07
tr|B4FNI7|B4FNI7_MAIZE Putative uncharacterized protein OS=Zea m... 57 8e-07
tr|A7QKE0|A7QKE0_VITVI Chromosome chr2 scaffold_112, whole genom... 56 1e-06
tr|A7NTN6|A7NTN6_VITVI Chromosome chr18 scaffold_1, whole genome... 55 2e-06
tr|Q7Y0C6|Q7Y0C6_ORYSJ Os03g0765800 protein OS=Oryza sativa subs... 55 3e-06
tr|Q6ZBH4|Q6ZBH4_ORYSJ Os08g0545000 protein OS=Oryza sativa subs... 55 3e-06
tr|Q10EM3|Q10EM3_ORYSJ Expressed protein OS=Oryza sativa subsp. ... 55 3e-06
tr|B8B9C3|B8B9C3_ORYSI Putative uncharacterized protein OS=Oryza... 55 3e-06
tr|A5BXA6|A5BXA6_VITVI Putative uncharacterized protein OS=Vitis... 55 3e-06
tr|A3AN05|A3AN05_ORYSJ Putative uncharacterized protein OS=Oryza... 55 3e-06
tr|A2YXQ3|A2YXQ3_ORYSI Putative uncharacterized protein OS=Oryza... 55 3e-06
tr|A2XMB0|A2XMB0_ORYSI Putative uncharacterized protein OS=Oryza... 55 3e-06
tr|Q2QMU3|Q2QMU3_ORYSJ Os12g0590900 protein OS=Oryza sativa subs... 54 4e-06
tr|A3CJ02|A3CJ02_ORYSJ Putative uncharacterized protein OS=Oryza... 54 4e-06
tr|A2ZM89|A2ZM89_ORYSI Putative uncharacterized protein OS=Oryza... 54 4e-06
tr|A7R4L8|A7R4L8_VITVI Chromosome undetermined scaffold_741, who... 54 5e-06
tr|A7R4E4|A7R4E4_VITVI Chromosome undetermined scaffold_670, who... 54 5e-06
tr|A5AMA2|A5AMA2_VITVI Putative uncharacterized protein OS=Vitis... 54 5e-06
tr|O23176|O23176_ARATH Putative uncharacterized protein C7A10.26... 52 2e-05
tr|O80468|O80468_ARATH Putative uncharacterized protein At2g2352... 52 2e-05
tr|Q9FGD5|Q9FGD5_ARATH Emb|CAB16785.1 OS=Arabidopsis thaliana GN... 51 3e-05
tr|A9REN7|A9REN7_PHYPA Predicted protein OS=Physcomitrella paten... 47 5e-04
tr|O82746|O82746_ARATH Putative uncharacterized protein F7H19.16... 47 8e-04
tr|Q5B1C3|Q5B1C3_EMENI Putative uncharacterized protein OS=Emeri... 38 0.38
tr|A9T5I1|A9T5I1_PHYPA Predicted protein OS=Physcomitrella paten... 35 2.5

>tr|A9RG94|A9RG94_PHYPA Predicted protein OS=Physcomitrella patens
subsp. patens GN=PHYPADRAFT_113639 PE=4 SV=1
Length = 574

Score = 61.6 bits (148), Expect = 2e-08
Identities = 28/39 (71%), Positives = 31/39 (79%)
Frame = +1

Query: 85 PQRVEVVTAALSILSDFEDVYRLWVFVAKFLDADFVSKE 201
P + VVTAAL +S FEDVYRLW FVAKFLDADFV +E
Sbjct: 522 PSEIPVVTAALGFVSTFEDVYRLWAFVAKFLDADFVKRE 560


>tr|A9TR75|A9TR75_PHYPA Predicted protein OS=Physcomitrella patens
subsp. patens GN=PHYPADRAFT_149364 PE=4 SV=1
Length = 637

Score = 60.1 bits (144), Expect = 7e-08
Identities = 30/48 (62%), Positives = 35/48 (72%)
Frame = +1

Query: 58 ARGEHHKGLPQRVEVVTAALSILSDFEDVYRLWVFVAKFLDADFVSKE 201
A G+H + P + VVTAAL +S FEDVYRLW FVAKFLDA FV +E
Sbjct: 578 AGGKHDR--PLEIPVVTAALGFVSTFEDVYRLWAFVAKFLDAGFVKRE 623


>tr|A9U2B6|A9U2B6_PHYPA Predicted protein OS=Physcomitrella patens
subsp. patens GN=PHYPADRAFT_154667 PE=4 SV=1
Length = 577

Score = 59.3 bits (142), Expect = 1e-07
Identities = 27/36 (75%), Positives = 30/36 (83%)
Frame = +1

Query: 94 VEVVTAALSILSDFEDVYRLWVFVAKFLDADFVSKE 201
+ VVTAAL +S FEDVYRLW FVAKFLDADFV +E
Sbjct: 528 ISVVTAALGFVSTFEDVYRLWAFVAKFLDADFVKRE 563


>tr|A7R1T5|A7R1T5_VITVI Chromosome undetermined scaffold_376, whole
genome shotgun sequence OS=Vitis vinifera
GN=GSVIVT00012400001 PE=4 SV=1
Length = 474

Score = 58.9 bits (141), Expect = 2e-07
Identities = 26/36 (72%), Positives = 31/36 (86%)
Frame = +1

Query: 94 VEVVTAALSILSDFEDVYRLWVFVAKFLDADFVSKE 201
+ VVTAAL L++FED+YRLW FVA+FLDADFV KE
Sbjct: 425 ITVVTAALGFLTNFEDIYRLWAFVAQFLDADFVEKE 460


>tr|Q9FGL6|Q9FGL6_ARATH Genomic DNA, chromosome 5, P1 clone:MJM18
(Putative uncharacterized protein) OS=Arabidopsis
thaliana GN=At5g51920 PE=2 SV=1
Length = 570

Score = 58.5 bits (140), Expect = 2e-07
Identities = 26/45 (57%), Positives = 36/45 (80%)
Frame = +1

Query: 91 RVEVVTAALSILSDFEDVYRLWVFVAKFLDADFVSKELGGQPLHV 225
R+ V+TAAL L++FEDVY+LW+FVA+FLD++FV KE +HV
Sbjct: 517 RISVLTAALGFLANFEDVYKLWIFVARFLDSEFVDKESVRCGVHV 561


>tr|B8A1Q9|B8A1Q9_MAIZE Putative uncharacterized protein OS=Zea mays
PE=2 SV=1
Length = 692

Score = 56.6 bits (135), Expect = 8e-07
Identities = 26/34 (76%), Positives = 28/34 (82%)
Frame = +1

Query: 100 VVTAALSILSDFEDVYRLWVFVAKFLDADFVSKE 201
VV A+L LS+FED YRLW FVAKFLDADFV KE
Sbjct: 645 VVNASLGFLSNFEDAYRLWAFVAKFLDADFVEKE 678


>tr|B4FNI7|B4FNI7_MAIZE Putative uncharacterized protein OS=Zea mays
PE=2 SV=1
Length = 278

Score = 56.6 bits (135), Expect = 8e-07
Identities = 26/34 (76%), Positives = 28/34 (82%)
Frame = +1

Query: 100 VVTAALSILSDFEDVYRLWVFVAKFLDADFVSKE 201
VV A+L LS+FED YRLW FVAKFLDADFV KE
Sbjct: 231 VVNASLGFLSNFEDAYRLWAFVAKFLDADFVEKE 264


>tr|A7QKE0|A7QKE0_VITVI Chromosome chr2 scaffold_112, whole genome
shotgun sequence OS=Vitis vinifera GN=GSVIVT00001078001
PE=4 SV=1
Length = 652

Score = 56.2 bits (134), Expect = 1e-06
Identities = 24/36 (66%), Positives = 31/36 (86%)
Frame = +1

Query: 94 VEVVTAALSILSDFEDVYRLWVFVAKFLDADFVSKE 201
+ VV+AAL +L++FEDVY LW FV++FLDADFV KE
Sbjct: 603 ISVVSAALGLLTNFEDVYNLWAFVSRFLDADFVEKE 638


>tr|A7NTN6|A7NTN6_VITVI Chromosome chr18 scaffold_1, whole genome
shotgun sequence OS=Vitis vinifera GN=GSVIVT00014738001
PE=4 SV=1
Length = 950

Score = 55.1 bits (131), Expect = 2e-06
Identities = 31/63 (49%), Positives = 43/63 (68%)
Frame = +1

Query: 4 GPDSTDSAHFATVNKNMYARGEHHKGLPQRVEVVTAALSILSDFEDVYRLWVFVAKFLDA 183
G D D+A + K+M + K + RVEVVTA+LS L++FEDVY++W FVAKFL++
Sbjct: 878 GLDPEDTA----LCKSMANCRQDGKDMFFRVEVVTASLSFLTNFEDVYKMWAFVAKFLNS 933

Query: 184 DFV 192
FV
Sbjct: 934 SFV 936


>tr|Q7Y0C6|Q7Y0C6_ORYSJ Os03g0765800 protein OS=Oryza sativa subsp.
japonica GN=OSJNBa0079B15.16 PE=4 SV=1
Length = 935

Score = 54.7 bits (130), Expect = 3e-06
Identities = 23/36 (63%), Positives = 31/36 (86%)
Frame = +1

Query: 94 VEVVTAALSILSDFEDVYRLWVFVAKFLDADFVSKE 201
+EVVTA+L L++FEDVYRLW FVAKFLD+ F+ ++
Sbjct: 889 IEVVTASLGFLTNFEDVYRLWAFVAKFLDSSFLEQQ 924