BP918235
Clone id YMU001_000111_B01
Library
Length 480
Definition Adiantum capillus-veneris mRNA. clone: YMU001_000111_B01.
Accession
Tissue type prothallium
Developmental stage -
Contig ID -
Sequence
GATCGAGATTGGATCTGACAGATCCTTGAAACAAGATTGGGTCTTGCGGAATAATGGAGA
GGCGCTGGCGTAAGTCATCAAGTCCAACAGACTTTATATTTACACCATCAATAACAATGT
CTCCAGCGCAGCGCTCATTCTCAACCATTCTGAATAATGCTGCAGCCAAGCTTGATTTTC
CTGCACCAGCCCGACCTGCAATACCTATTTTCTCCCTTGCATTGATCTTGAATGAGATGT
TGTTTAAGACAGGCGGTAAATCTACTCTATAAGTCATAGTATACTTCACAAATTCTATTT
CTCCTCTAGAGGGCCAACCTTCTTCAACGATCCCTGGCGAAGTATTGGGATCAGCTTCAG
TGGTTAAATTGGCATAAGCATTGATTCTTTCTACACTTGTAAAGTAATTCTCCACTTCTG
CTGCTTGTCGAATAGCATACTGGACAGATCCAGTCACCTGCATGCTCTGCACTAGAACGA
■■Homology search results ■■ -
sp_hit_id O15440
Definition sp|O15440|MRP5_HUMAN Multidrug resistance-associated protein 5 OS=Homo sapiens
Align length 156
Score (bit) 112.0
E-value 1.0e-24
Report
BLASTX 2.2.19 [Nov-02-2008]


Reference: Altschul, Stephen F., Thomas L. Madden, Alejandro A. Schaffer,
Jinghui Zhang, Zheng Zhang, Webb Miller, and David J. Lipman (1997),
"Gapped BLAST and PSI-BLAST: a new generation of protein database search
programs", Nucleic Acids Res. 25:3389-3402.

Query= BP918235|Adiantum capillus-veneris mRNA, clone:
YMU001_000111_B01.
(480 letters)

Database: uniprot_sprot.fasta
412,525 sequences; 148,809,765 total letters

Searching..................................................done



Score E
Sequences producing significant alignments: (bits) Value

sp|O15440|MRP5_HUMAN Multidrug resistance-associated protein 5 O... 112 1e-24
sp|Q9QYM0|MRP5_RAT Multidrug resistance-associated protein 5 OS=... 111 2e-24
sp|Q5F364|MRP1_CHICK Multidrug resistance-associated protein 1 O... 110 3e-24
sp|P14772|BPT1_YEAST Bile pigment transporter 1 OS=Saccharomyces... 110 3e-24
sp|Q10185|ABC2_SCHPO ATP-binding cassette transporter abc2 OS=Sc... 109 6e-24
sp|O15438|MRP3_HUMAN Canalicular multispecific organic anion tra... 109 7e-24
sp|Q8VI47|MRP2_MOUSE Canalicular multispecific organic anion tra... 109 7e-24
sp|B2RX12|MRP3_MOUSE Canalicular multispecific organic anion tra... 108 1e-23
sp|Q9R1X5|MRP5_MOUSE Multidrug resistance-associated protein 5 O... 108 2e-23
sp|Q63120|MRP2_RAT Canalicular multispecific organic anion trans... 107 4e-23
sp|P33527|MRP1_HUMAN Multidrug resistance-associated protein 1 O... 106 5e-23
sp|Q864R9|MRP1_MACFA Multidrug resistance-associated protein 1 O... 106 6e-23
sp|Q54P13|ABCC8_DICDI ABC transporter C family member 8 OS=Dicty... 105 8e-23
sp|Q92887|MRP2_HUMAN Canalicular multispecific organic anion tra... 105 1e-22
sp|O88563|MRP3_RAT Canalicular multispecific organic anion trans... 103 3e-22
sp|Q28689|MRP2_RABIT Canalicular multispecific organic anion tra... 102 7e-22
sp|Q8CG09|MRP1_RAT Multidrug resistance-associated protein 1 OS=... 102 7e-22
sp|O35379|MRP1_MOUSE Multidrug resistance-associated protein 1 O... 102 7e-22
sp|Q54V86|ABCCD_DICDI ABC transporter C family member 13 OS=Dict... 102 7e-22
sp|Q96J66|ABCCB_HUMAN ATP-binding cassette transporter sub-famil... 102 7e-22
sp|P39109|YCFI_YEAST Metal resistance protein YCF1 OS=Saccharomy... 102 9e-22
sp|Q9C8H1|MRP12_ARATH Multidrug resistance-associated protein 12... 102 9e-22
sp|Q54VJ0|ABCC2_DICDI ABC transporter C family member 2 OS=Dicty... 101 2e-21
sp|Q6UR05|MRP1_CANFA Multidrug resistance-associated protein 1 O... 101 2e-21
sp|O95255|MRP6_HUMAN Multidrug resistance-associated protein 6 O... 100 3e-21
sp|Q8ST87|ABCCA_DICDI ABC transporter C family member 10 OS=Dict... 99 8e-21
sp|Q80WJ6|MRP9_MOUSE Multidrug resistance-associated protein 9 O... 99 1e-20
sp|Q8HXQ5|MRP1_BOVIN Multidrug resistance-associated protein 1 O... 99 1e-20
sp|Q9C8G9|MRP1_ARATH Multidrug resistance-associated protein 1 O... 99 1e-20
sp|Q42093|MRP2_ARATH Multidrug resistance-associated protein 2 O... 98 2e-20

>sp|O15440|MRP5_HUMAN Multidrug resistance-associated protein 5
OS=Homo sapiens GN=ABCC5 PE=1 SV=2
Length = 1437

Score = 112 bits (279), Expect = 1e-24
Identities = 68/156 (43%), Positives = 84/156 (53%), Gaps = 1/156 (0%)
Frame = -3

Query: 466 SMQVTGSVQYAIRQAAEVENYFTSVERINAYAN-LTTEADPNTSPGIVEEGWPSRGEIEF 290
++Q+TG Q+ +R A+E E FTSVERIN Y L+ EA WP GE+ F
Sbjct: 1136 AVQLTGLFQFTVRLASETEARFTSVERINHYIKTLSLEAPARIKNKAPSPDWPQEGEVTF 1195

Query: 289 VKYTMTYRVDLPPVLNNISFKINXXXXXXXXXXXXXXXXXXXXXLFRMVENERCAGDIVI 110
M YR +LP VL +SF I LFR+VE G I I
Sbjct: 1196 ENAEMRYRENLPLVLKKVSFTIKPKEKIGIVGRTGSGKSSLGMALFRLVELS--GGCIKI 1253

Query: 109 DGVNIKSVGLDDLRQRLSIIPQDPILFQGSVRSNLD 2
DGV I +GL DLR +LSIIPQ+P+LF G+VRSNLD
Sbjct: 1254 DGVRISDIGLADLRSKLSIIPQEPVLFSGTVRSNLD 1289


>sp|Q9QYM0|MRP5_RAT Multidrug resistance-associated protein 5
OS=Rattus norvegicus GN=Abcc5 PE=2 SV=1
Length = 1436

Score = 111 bits (277), Expect = 2e-24
Identities = 68/156 (43%), Positives = 84/156 (53%), Gaps = 1/156 (0%)
Frame = -3

Query: 466 SMQVTGSVQYAIRQAAEVENYFTSVERINAYAN-LTTEADPNTSPGIVEEGWPSRGEIEF 290
++Q+TG Q+ +R A+E E FTSVERIN Y L+ EA WP GEI F
Sbjct: 1135 AVQLTGLFQFTVRLASETEARFTSVERINHYIKTLSLEAPARIKNKAPPHDWPQEGEITF 1194

Query: 289 VKYTMTYRVDLPPVLNNISFKINXXXXXXXXXXXXXXXXXXXXXLFRMVENERCAGDIVI 110
M YR +LP VL +SF I LFR+VE G I I
Sbjct: 1195 ENAEMRYRENLPLVLKKVSFTIKPKEKIGIVGRTGSGKSSLGMALFRLVELS--GGCIKI 1252

Query: 109 DGVNIKSVGLDDLRQRLSIIPQDPILFQGSVRSNLD 2
DGV I +GL DLR +L+IIPQ+P+LF G+VRSNLD
Sbjct: 1253 DGVRISDIGLADLRSKLTIIPQEPVLFSGTVRSNLD 1288


>sp|Q5F364|MRP1_CHICK Multidrug resistance-associated protein 1
OS=Gallus gallus GN=ABCC1 PE=2 SV=1
Length = 1525

Score = 110 bits (276), Expect = 3e-24
Identities = 59/155 (38%), Positives = 86/155 (55%)
Frame = -3

Query: 466 SMQVTGSVQYAIRQAAEVENYFTSVERINAYANLTTEADPNTSPGIVEEGWPSRGEIEFV 287
S+Q+T + + +R +++E +VER+ YA + EA+ + WP G++EF
Sbjct: 1231 SLQITAYLNWLVRMTSDLETNIVAVERVKEYAEMEKEAEWSIEETAPASTWPQEGKVEFR 1290

Query: 286 KYTMTYRVDLPPVLNNISFKINXXXXXXXXXXXXXXXXXXXXXLFRMVENERCAGDIVID 107
+ + YR DL VL NI+ IN LFR+ NE G+I+ID
Sbjct: 1291 GFGLRYREDLDLVLKNINITINGGEKVGIVGRTGAGKSSLTLGLFRI--NEAAEGEIIID 1348

Query: 106 GVNIKSVGLDDLRQRLSIIPQDPILFQGSVRSNLD 2
G+NI +GL DLR +++IIPQDPILF GS+R NLD
Sbjct: 1349 GINIAKIGLHDLRFKITIIPQDPILFSGSLRMNLD 1383


>sp|P14772|BPT1_YEAST Bile pigment transporter 1 OS=Saccharomyces
cerevisiae GN=BPT1 PE=1 SV=2
Length = 1559

Score = 110 bits (276), Expect = 3e-24
Identities = 63/155 (40%), Positives = 85/155 (54%)
Frame = -3

Query: 466 SMQVTGSVQYAIRQAAEVENYFTSVERINAYANLTTEADPNTSPGIVEEGWPSRGEIEFV 287
S++VTGS+ + +R +E SVERI Y L EA +E WPS+G IEF
Sbjct: 1246 SLEVTGSLTWIVRTTVTIETNIVSVERIVEYCELPPEAQSINPEKRPDENWPSKGGIEFK 1305

Query: 286 KYTMTYRVDLPPVLNNISFKINXXXXXXXXXXXXXXXXXXXXXLFRMVENERCAGDIVID 107
Y+ YR +L PVLNNI+ KI LFR++E G I+ID
Sbjct: 1306 NYSTKYRENLDPVLNNINVKIEPCEKVGIVGRTGAGKSTLSLALFRILEPTE--GKIIID 1363

Query: 106 GVNIKSVGLDDLRQRLSIIPQDPILFQGSVRSNLD 2
G++I +GL DLR L+IIPQD F+G+V++NLD
Sbjct: 1364 GIDISDIGLFDLRSHLAIIPQDAQAFEGTVKTNLD 1398


>sp|Q10185|ABC2_SCHPO ATP-binding cassette transporter abc2
OS=Schizosaccharomyces pombe GN=abc2 PE=1 SV=1
Length = 1478

Score = 109 bits (273), Expect = 6e-24
Identities = 63/158 (39%), Positives = 89/158 (56%)
Frame = -3

Query: 475 LVQSMQVTGSVQYAIRQAAEVENYFTSVERINAYANLTTEADPNTSPGIVEEGWPSRGEI 296
L ++Q+T S+ + +RQ+ +VE SVER+ Y L +EA EGWPS G I
Sbjct: 1180 LSYAVQITQSLTFVVRQSVDVETNIVSVERMLEYIGLPSEAPSIIPDHRPPEGWPSHGAI 1239

Query: 295 EFVKYTMTYRVDLPPVLNNISFKINXXXXXXXXXXXXXXXXXXXXXLFRMVENERCAGDI 116
+F Y++ YR +LP VLN+IS I LFR++E +GDI
Sbjct: 1240 KFDHYSVRYRENLPLVLNDISVNIKPQEKIGIVGRTGAGKSTLTLALFRLIEPT--SGDI 1297

Query: 115 VIDGVNIKSVGLDDLRQRLSIIPQDPILFQGSVRSNLD 2
+D +NI S+GL DLR RL+IIPQ+ F+G++R NLD
Sbjct: 1298 QLDDINITSIGLHDLRSRLAIIPQENQAFEGTIRENLD 1335


>sp|O15438|MRP3_HUMAN Canalicular multispecific organic anion
transporter 2 OS=Homo sapiens GN=ABCC3 PE=2 SV=3
Length = 1527

Score = 109 bits (272), Expect = 7e-24
Identities = 63/160 (39%), Positives = 93/160 (58%), Gaps = 5/160 (3%)
Frame = -3

Query: 466 SMQVTGSVQYAIRQAAEVENYFTSVERINAYANLTTEADPNTSPGIVE-----EGWPSRG 302
S+QVT ++ + IR +++E+ +VER+ Y+ TEA P +VE EGWP RG
Sbjct: 1233 SLQVTFALNWMIRMMSDLESNIVAVERVKEYSKTETEA-----PWVVEGSRPPEGWPPRG 1287

Query: 301 EIEFVKYTMTYRVDLPPVLNNISFKINXXXXXXXXXXXXXXXXXXXXXLFRMVENERCAG 122
E+EF Y++ YR L VL ++S ++ LFR++E + G
Sbjct: 1288 EVEFRNYSVRYRPGLDLVLRDLSLHVHGGEKVGIVGRTGAGKSSMTLCLFRILEAAK--G 1345

Query: 121 DIVIDGVNIKSVGLDDLRQRLSIIPQDPILFQGSVRSNLD 2
+I IDG+N+ +GL DLR +L+IIPQDPILF G++R NLD
Sbjct: 1346 EIRIDGLNVADIGLHDLRSQLTIIPQDPILFSGTLRMNLD 1385


>sp|Q8VI47|MRP2_MOUSE Canalicular multispecific organic anion
transporter 1 OS=Mus musculus GN=Abcc2 PE=2 SV=1
Length = 1543

Score = 109 bits (272), Expect = 7e-24
Identities = 63/159 (39%), Positives = 89/159 (55%)
Frame = -3

Query: 478 VLVQSMQVTGSVQYAIRQAAEVENYFTSVERINAYANLTTEADPNTSPGIVEEGWPSRGE 299
VL ++ +T ++ + +R +EVE +VERIN Y N+ EA P + WP +GE
Sbjct: 1239 VLSNALNITQTLNWLVRMTSEVETNIVAVERINEYINVDNEA-PWVTDKKPPADWPKKGE 1297

Query: 298 IEFVKYTMTYRVDLPPVLNNISFKINXXXXXXXXXXXXXXXXXXXXXLFRMVENERCAGD 119
I+F Y + YR +L VL I+ I LFR++E+ G
Sbjct: 1298 IQFNNYQVRYRPELDLVLKGITCNIKSTEKVGVVGRTGAGKSSLTNCLFRILES--AGGQ 1355

Query: 118 IVIDGVNIKSVGLDDLRQRLSIIPQDPILFQGSVRSNLD 2
I+IDG++I S+GL DLR RL+IIPQDPILF G++R NLD
Sbjct: 1356 IIIDGIDIASIGLHDLRGRLTIIPQDPILFSGNLRMNLD 1394


>sp|B2RX12|MRP3_MOUSE Canalicular multispecific organic anion
transporter 2 OS=Mus musculus GN=Abcc3 PE=1 SV=1
Length = 1523

Score = 108 bits (271), Expect = 1e-23
Identities = 59/155 (38%), Positives = 88/155 (56%)
Frame = -3

Query: 466 SMQVTGSVQYAIRQAAEVENYFTSVERINAYANLTTEADPNTSPGIVEEGWPSRGEIEFV 287
++QVT ++ + IR +++E+ +VER+ Y+ TEA EGWP+RG +EF
Sbjct: 1229 ALQVTMALNWMIRMISDLESNIIAVERVKEYSKTKTEAPWVVESNRAPEGWPTRGMVEFR 1288

Query: 286 KYTMTYRVDLPPVLNNISFKINXXXXXXXXXXXXXXXXXXXXXLFRMVENERCAGDIVID 107
Y++ YR L VL N++ + LFR++E G+IVID
Sbjct: 1289 NYSVRYRPGLELVLKNVTVHVQGGEKVGIVGRTGAGKSSMTLCLFRILE--AAEGEIVID 1346

Query: 106 GVNIKSVGLDDLRQRLSIIPQDPILFQGSVRSNLD 2
G+N+ +GL DLR +L+IIPQDPILF G++R NLD
Sbjct: 1347 GLNVAHIGLHDLRSQLTIIPQDPILFSGTLRMNLD 1381


>sp|Q9R1X5|MRP5_MOUSE Multidrug resistance-associated protein 5 OS=Mus
musculus GN=Abcc5 PE=2 SV=1
Length = 1436

Score = 108 bits (269), Expect = 2e-23
Identities = 65/156 (41%), Positives = 83/156 (53%), Gaps = 1/156 (0%)
Frame = -3

Query: 466 SMQVTGSVQYAIRQAAEVENYFTSVERINAYAN-LTTEADPNTSPGIVEEGWPSRGEIEF 290
++Q+ G Q+ +R A+E E FTSVERIN Y L+ EA WP GE+ F
Sbjct: 1135 AVQLIGLFQFTVRLASETEARFTSVERINHYIKTLSLEAPARIKNKAPPHDWPQEGEVTF 1194

Query: 289 VKYTMTYRVDLPPVLNNISFKINXXXXXXXXXXXXXXXXXXXXXLFRMVENERCAGDIVI 110
M YR +LP VL +SF I LFR+VE G I I
Sbjct: 1195 ENAEMRYRENLPLVLKKVSFTIKPKEKIGIVGRTGSGKSSLGMALFRLVELS--GGCIKI 1252

Query: 109 DGVNIKSVGLDDLRQRLSIIPQDPILFQGSVRSNLD 2
DG+ I +GL DLR +L+IIPQ+P+LF G+VRSNLD
Sbjct: 1253 DGIRISDIGLADLRSKLAIIPQEPVLFSGTVRSNLD 1288


>sp|Q63120|MRP2_RAT Canalicular multispecific organic anion
transporter 1 OS=Rattus norvegicus GN=Abcc2 PE=2 SV=1
Length = 1541

Score = 107 bits (266), Expect = 4e-23
Identities = 61/159 (38%), Positives = 88/159 (55%)
Frame = -3

Query: 478 VLVQSMQVTGSVQYAIRQAAEVENYFTSVERINAYANLTTEADPNTSPGIVEEGWPSRGE 299
VL ++ +T ++ + +R +E E +VERI+ Y N+ EA P + WP GE
Sbjct: 1237 VLSNALNITQTLNWLVRMTSEAETNIVAVERISEYINVENEA-PWVTDKRPPADWPRHGE 1295

Query: 298 IEFVKYTMTYRVDLPPVLNNISFKINXXXXXXXXXXXXXXXXXXXXXLFRMVENERCAGD 119
I+F Y + YR +L VL I+ I LFR++E+ G
Sbjct: 1296 IQFNNYQVRYRPELDLVLKGITCNIKSGEKVGVVGRTGAGKSSLTNCLFRILES--AGGQ 1353

Query: 118 IVIDGVNIKSVGLDDLRQRLSIIPQDPILFQGSVRSNLD 2
I+IDG+++ S+GL DLR+RL+IIPQDPILF GS+R NLD
Sbjct: 1354 IIIDGIDVASIGLHDLRERLTIIPQDPILFSGSLRMNLD 1392


tr_hit_id A9U0H3
Definition tr|A9U0H3|A9U0H3_PHYPA ATP-binding cassette transporter, subfamily C, member 10, group MRP protein PpABCC10 (Fragment) OS=Physcomitrella patens subsp. patens
Align length 159
Score (bit) 186.0
E-value 5.0e-46
Report
BLASTX 2.2.19 [Nov-02-2008]


Reference: Altschul, Stephen F., Thomas L. Madden, Alejandro A. Schaffer,
Jinghui Zhang, Zheng Zhang, Webb Miller, and David J. Lipman (1997),
"Gapped BLAST and PSI-BLAST: a new generation of protein database search
programs", Nucleic Acids Res. 25:3389-3402.

Query= BP918235|Adiantum capillus-veneris mRNA, clone:
YMU001_000111_B01.
(480 letters)

Database: uniprot_trembl.fasta
7,341,751 sequences; 2,391,615,440 total letters

Searching..................................................done



Score E
Sequences producing significant alignments: (bits) Value

tr|A9U0H3|A9U0H3_PHYPA ATP-binding cassette transporter, subfami... 186 5e-46
tr|B6PSW4|B6PSW4_BRAFL Putative uncharacterized protein (Fragmen... 117 3e-25
tr|B6PSW1|B6PSW1_BRAFL Putative uncharacterized protein (Fragmen... 115 1e-24
tr|B6PRB5|B6PRB5_BRAFL Putative uncharacterized protein (Fragmen... 115 1e-24
tr|Q4RTF4|Q4RTF4_TETNG Chromosome 1 SCAF14998, whole genome shot... 114 2e-24
tr|A5DGA2|A5DGA2_PICGU Putative uncharacterized protein OS=Pichi... 114 3e-24
tr|B6M7E1|B6M7E1_BRAFL Putative uncharacterized protein OS=Branc... 113 4e-24
tr|B3RLZ7|B3RLZ7_TRIAD Putative uncharacterized protein (Fragmen... 113 4e-24
tr|Q86UX3|Q86UX3_HUMAN ATP-binding cassette C5 splicing variant ... 112 1e-23
tr|Q59FK6|Q59FK6_HUMAN Multidrug resistance-associated protein 5... 112 1e-23
tr|Q5AZ37|Q5AZ37_EMENI Putative uncharacterized protein OS=Emeri... 112 1e-23
tr|B2AWI8|B2AWI8_PODAN Predicted CDS Pa_7_7310 OS=Podospora anse... 111 2e-23
tr|A5DYE9|A5DYE9_LODEL Oligomycin resistance ATP-dependent perme... 111 2e-23
tr|A7Q1C1|A7Q1C1_VITVI Chromosome chr10 scaffold_43, whole genom... 111 2e-23
tr|Q19AV9|Q19AV9_PIG Multi-drug resistance associated protein 2 ... 111 2e-23
tr|Q5KJN9|Q5KJN9_CRYNE Metal resistance protein ycf1, putative (... 111 2e-23
tr|A7TJ24|A7TJ24_VANPO Putative uncharacterized protein OS=Vande... 111 2e-23
tr|Q9GK09|Q9GK09_CANFA Multidrug resistance protein 2 OS=Canis f... 110 3e-23
tr|Q95M36|Q95M36_CANFA Multidrug resistance protein 2 OS=Canis f... 110 3e-23
tr|Q6PSM3|Q6PSM3_CANFA Multidrug resistance protein 2 OS=Canis f... 110 3e-23
tr|Q59XS4|Q59XS4_CANAL ABC transporter OS=Candida albicans GN=Ca... 110 3e-23
tr|O93859|O93859_CANAL YOR1 homolog (Fragment) OS=Candida albica... 110 3e-23
tr|Q5CZY2|Q5CZY2_MOUSE ATP-binding cassette, sub-family C (CFTR/... 110 3e-23
tr|A0ST32|A0ST32_CANFA ATP-binding cassette sub-family C member ... 110 3e-23
tr|B5VMT0|B5VMT0_YEAS6 YLL015Wp-like protein OS=Saccharomyces ce... 110 3e-23
tr|A7A0P1|A7A0P1_YEAS7 ABC type transmembrane transporter OS=Sac... 110 3e-23
tr|A9JRK6|A9JRK6_XENTR LOC100135090 protein OS=Xenopus tropicali... 110 5e-23
tr|B7FRM3|B7FRM3_PHATR Predicted protein (Fragment) OS=Phaeodact... 110 5e-23
tr|A9TWW4|A9TWW4_PHYPA ATP-binding cassette transporter, subfami... 110 5e-23
tr|Q2H9A1|Q2H9A1_CHAGB Putative uncharacterized protein OS=Chaet... 110 5e-23

>tr|A9U0H3|A9U0H3_PHYPA ATP-binding cassette transporter, subfamily C,
member 10, group MRP protein PpABCC10 (Fragment)
OS=Physcomitrella patens subsp. patens GN=ppabcc10 PE=3
SV=1
Length = 879

Score = 186 bits (472), Expect = 5e-46
Identities = 91/159 (57%), Positives = 114/159 (71%)
Frame = -3

Query: 478 VLVQSMQVTGSVQYAIRQAAEVENYFTSVERINAYANLTTEADPNTSPGIVEEGWPSRGE 299
VLVQS+Q+TG QY +R AAE ENYFTSVERI AY L TEAD +T+PG++ E WP +GE
Sbjct: 542 VLVQSLQLTGFFQYGVRLAAETENYFTSVERIQAYTELPTEADSDTAPGVITEKWPEKGE 601

Query: 298 IEFVKYTMTYRVDLPPVLNNISFKINXXXXXXXXXXXXXXXXXXXXXLFRMVENERCAGD 119
IEFV YTM YR DLP VLN++ FK+N +FR+VEN+ C+G
Sbjct: 602 IEFVHYTMAYREDLPRVLNDLCFKVNSQEKVGILGRTGAGKSSLAAAMFRLVENKACSGR 661

Query: 118 IVIDGVNIKSVGLDDLRQRLSIIPQDPILFQGSVRSNLD 2
I+ID ++I +GLDDLR+RLSIIPQDP+LF+G+VR NLD
Sbjct: 662 ILIDDIDIAHIGLDDLRRRLSIIPQDPVLFRGTVRLNLD 700


>tr|B6PSW4|B6PSW4_BRAFL Putative uncharacterized protein (Fragment)
OS=Branchiostoma floridae GN=BRAFLDRAFT_256214 PE=4 SV=1
Length = 611

Score = 117 bits (293), Expect = 3e-25
Identities = 67/159 (42%), Positives = 89/159 (55%), Gaps = 1/159 (0%)
Frame = -3

Query: 475 LVQSMQVTGSVQYAIRQAAEVENYFTSVERINAYAN-LTTEADPNTSPGIVEEGWPSRGE 299
L +++TG QY +R ++E E +FTSV+RIN+Y L EA E WP G
Sbjct: 306 LTSVIEMTGLFQYTVRLSSETEAHFTSVQRINSYIKGLEPEAPLTVKETAPPESWPVEGR 365

Query: 298 IEFVKYTMTYRVDLPPVLNNISFKINXXXXXXXXXXXXXXXXXXXXXLFRMVENERCAGD 119
++F KY M YR LP VL ++SF LFR+VE +G
Sbjct: 366 VQFQKYNMRYREGLPLVLKHVSFSTRLSEKVGIVGRTGSGKSSLGVALFRLVE--AASGS 423

Query: 118 IVIDGVNIKSVGLDDLRQRLSIIPQDPILFQGSVRSNLD 2
I ID V+I ++GL+DLR +LSIIPQDP+LF G+VR NLD
Sbjct: 424 ISIDDVDISTIGLEDLRSKLSIIPQDPVLFVGTVRYNLD 462


>tr|B6PSW1|B6PSW1_BRAFL Putative uncharacterized protein (Fragment)
OS=Branchiostoma floridae GN=BRAFLDRAFT_256206 PE=4 SV=1
Length = 1325

Score = 115 bits (287), Expect = 1e-24
Identities = 66/155 (42%), Positives = 87/155 (56%), Gaps = 1/155 (0%)
Frame = -3

Query: 463 MQVTGSVQYAIRQAAEVENYFTSVERINAYAN-LTTEADPNTSPGIVEEGWPSRGEIEFV 287
+Q+TG Q+ +R ++E E FTSV+RIN+Y L EA + WPS G + F
Sbjct: 1025 IQMTGMFQFTVRLSSETEARFTSVQRINSYIKGLKPEAPLTIKKTAPAQSWPSEGRVRFQ 1084

Query: 286 KYTMTYRVDLPPVLNNISFKINXXXXXXXXXXXXXXXXXXXXXLFRMVENERCAGDIVID 107
KY M YR LP VL ++SF LFR+VE +G I ID
Sbjct: 1085 KYNMRYREGLPLVLKDVSFSTRPSEKVGIVGRTGSGKSSLGVALFRLVE--AASGSISID 1142

Query: 106 GVNIKSVGLDDLRQRLSIIPQDPILFQGSVRSNLD 2
V+I ++GL+DLR +LSIIPQDP+LF G+VR NLD
Sbjct: 1143 DVDISTIGLEDLRSKLSIIPQDPVLFVGTVRYNLD 1177


>tr|B6PRB5|B6PRB5_BRAFL Putative uncharacterized protein (Fragment)
OS=Branchiostoma floridae GN=BRAFLDRAFT_255403 PE=4 SV=1
Length = 1308

Score = 115 bits (287), Expect = 1e-24
Identities = 66/155 (42%), Positives = 87/155 (56%), Gaps = 1/155 (0%)
Frame = -3

Query: 463 MQVTGSVQYAIRQAAEVENYFTSVERINAYAN-LTTEADPNTSPGIVEEGWPSRGEIEFV 287
+Q+TG Q+ +R ++E E FTSV+RIN+Y L EA + WPS G + F
Sbjct: 1008 IQMTGMFQFTVRLSSETEARFTSVQRINSYIKGLKPEAPLTIKKTAPAQSWPSEGSVRFQ 1067

Query: 286 KYTMTYRVDLPPVLNNISFKINXXXXXXXXXXXXXXXXXXXXXLFRMVENERCAGDIVID 107
KY M YR LP VL ++SF LFR+VE +G I ID
Sbjct: 1068 KYNMRYREGLPLVLKDVSFSTKTSEKVGIVGRTGSGKSSLGVALFRLVE--AASGSISID 1125

Query: 106 GVNIKSVGLDDLRQRLSIIPQDPILFQGSVRSNLD 2
V+I ++GL+DLR +LSIIPQDP+LF G+VR NLD
Sbjct: 1126 DVDISTIGLEDLRSKLSIIPQDPVLFVGTVRYNLD 1160


>tr|Q4RTF4|Q4RTF4_TETNG Chromosome 1 SCAF14998, whole genome shotgun
sequence. (Fragment) OS=Tetraodon nigroviridis
GN=GSTENG00029278001 PE=3 SV=1
Length = 1413

Score = 114 bits (285), Expect = 2e-24
Identities = 65/157 (41%), Positives = 85/157 (54%), Gaps = 2/157 (1%)
Frame = -3

Query: 466 SMQVTGSVQYAIRQAAEVENYFTSVERINAYANLTTEADPNTSPGIVEEG--WPSRGEIE 293
++Q+TG Q+ +R E E FTSVERIN Y P S G WP +G+I
Sbjct: 1115 AVQLTGLFQFTVRLLTETEARFTSVERINHYIKCLQSEGPRRSHGAAAPAPSWPQQGKIT 1174

Query: 292 FVKYTMTYRVDLPPVLNNISFKINXXXXXXXXXXXXXXXXXXXXXLFRMVENERCAGDIV 113
F + Y DLP VL N+SF + LFR+VE G I+
Sbjct: 1175 FQDVELRYHEDLPLVLKNLSFTVLPAETIGIVGRTGSGKSSLGAALFRLVE--LAGGSII 1232

Query: 112 IDGVNIKSVGLDDLRQRLSIIPQDPILFQGSVRSNLD 2
IDG+NI +GLDDLR +++IIPQ+P+LF G+VRSNLD
Sbjct: 1233 IDGINIAQIGLDDLRSKVAIIPQEPVLFIGTVRSNLD 1269


>tr|A5DGA2|A5DGA2_PICGU Putative uncharacterized protein OS=Pichia
guilliermondii GN=PGUG_02303 PE=3 SV=2
Length = 1291

Score = 114 bits (284), Expect = 3e-24
Identities = 66/154 (42%), Positives = 88/154 (57%)
Frame = -3

Query: 463 MQVTGSVQYAIRQAAEVENYFTSVERINAYANLTTEADPNTSPGIVEEGWPSRGEIEFVK 284
+Q+T + +R +VEN SVER+N YA + E + G + E WPS+G+I+F
Sbjct: 980 LQITQQMIQMMRSLTQVENQMNSVERLNQYA-MYLEQEAPYKLGPLPENWPSKGQIQFNN 1038

Query: 283 YTMTYRVDLPPVLNNISFKINXXXXXXXXXXXXXXXXXXXXXLFRMVENERCAGDIVIDG 104
++ YR LP VL N++F I LFR+ NE +G IVID
Sbjct: 1039 VSVAYRKGLPLVLKNLNFSIKAGEKIGICGRTGAGKSSIMNTLFRI--NELSSGSIVIDD 1096

Query: 103 VNIKSVGLDDLRQRLSIIPQDPILFQGSVRSNLD 2
++I +GL+DLR RLSIIPQDPILF GSVR NLD
Sbjct: 1097 IDISKIGLEDLRSRLSIIPQDPILFVGSVRRNLD 1130


>tr|B6M7E1|B6M7E1_BRAFL Putative uncharacterized protein
OS=Branchiostoma floridae GN=BRAFLDRAFT_280495 PE=4 SV=1
Length = 1288

Score = 113 bits (283), Expect = 4e-24
Identities = 66/159 (41%), Positives = 87/159 (54%), Gaps = 1/159 (0%)
Frame = -3

Query: 475 LVQSMQVTGSVQYAIRQAAEVENYFTSVERINAYAN-LTTEADPNTSPGIVEEGWPSRGE 299
L +Q+TG Q+ +R ++EVE TSV+RIN+Y L EA + WPS G
Sbjct: 988 LTSVIQMTGMFQFTVRLSSEVEARITSVQRINSYIKGLKPEAPLTIKKTAPAQSWPSEGR 1047

Query: 298 IEFVKYTMTYRVDLPPVLNNISFKINXXXXXXXXXXXXXXXXXXXXXLFRMVENERCAGD 119
+ F KY M YR LP VL ++SF LFR+ E +G
Sbjct: 1048 VRFQKYNMRYREGLPLVLKDVSFSTRPSEKVGIVGRTGSGKSSLGVALFRL--GEAASGS 1105

Query: 118 IVIDGVNIKSVGLDDLRQRLSIIPQDPILFQGSVRSNLD 2
I ID V+I ++GL+DLR +LSIIPQDP+LF G+VR NLD
Sbjct: 1106 ISIDDVDISTIGLEDLRSKLSIIPQDPVLFVGTVRYNLD 1144


>tr|B3RLZ7|B3RLZ7_TRIAD Putative uncharacterized protein (Fragment)
OS=Trichoplax adhaerens GN=TRIADDRAFT_19283 PE=4 SV=1
Length = 1269

Score = 113 bits (283), Expect = 4e-24
Identities = 65/159 (40%), Positives = 88/159 (55%), Gaps = 1/159 (0%)
Frame = -3

Query: 475 LVQSMQVTGSVQYAIRQAAEVENYFTSVERINAYA-NLTTEADPNTSPGIVEEGWPSRGE 299
L + Q+TG QY +R AAE E FTSVER+ Y N E +T + + WP G+
Sbjct: 946 LSYAFQLTGMFQYTVRNAAEAEARFTSVERLRDYVVNTENEGKRHTKLIQLPKKWPFEGQ 1005

Query: 298 IEFVKYTMTYRVDLPPVLNNISFKINXXXXXXXXXXXXXXXXXXXXXLFRMVENERCAGD 119
+ F + M Y DLP VL+++ F I ++R+VE E +G
Sbjct: 1006 VTFHQVQMRYHPDLPLVLHDMDFHIRAGEKVGIIGRTGSGKSSIGACMYRLVEVE--SGK 1063

Query: 118 IVIDGVNIKSVGLDDLRQRLSIIPQDPILFQGSVRSNLD 2
I++DGVNI +GLDDLR L IIPQDP+LF G++R NLD
Sbjct: 1064 IIVDGVNISMLGLDDLRSNLCIIPQDPLLFSGTLRKNLD 1102


>tr|Q86UX3|Q86UX3_HUMAN ATP-binding cassette C5 splicing variant A
OS=Homo sapiens GN=ABCC5 PE=2 SV=1
Length = 1394

Score = 112 bits (279), Expect = 1e-23
Identities = 68/156 (43%), Positives = 84/156 (53%), Gaps = 1/156 (0%)
Frame = -3

Query: 466 SMQVTGSVQYAIRQAAEVENYFTSVERINAYAN-LTTEADPNTSPGIVEEGWPSRGEIEF 290
++Q+TG Q+ +R A+E E FTSVERIN Y L+ EA WP GE+ F
Sbjct: 1093 AVQLTGLFQFTVRLASETEARFTSVERINHYIKTLSLEAPARIKNKAPSPDWPQEGEVTF 1152

Query: 289 VKYTMTYRVDLPPVLNNISFKINXXXXXXXXXXXXXXXXXXXXXLFRMVENERCAGDIVI 110
M YR +LP VL +SF I LFR+VE G I I
Sbjct: 1153 ENAEMRYRENLPLVLKKVSFTIKPKEKIGIVGRTGSGKSSLGMALFRLVELS--GGCIKI 1210

Query: 109 DGVNIKSVGLDDLRQRLSIIPQDPILFQGSVRSNLD 2
DGV I +GL DLR +LSIIPQ+P+LF G+VRSNLD
Sbjct: 1211 DGVRISDIGLADLRSKLSIIPQEPVLFSGTVRSNLD 1246


>tr|Q59FK6|Q59FK6_HUMAN Multidrug resistance-associated protein 5
variant (Fragment) OS=Homo sapiens PE=2 SV=1
Length = 1430

Score = 112 bits (279), Expect = 1e-23
Identities = 68/156 (43%), Positives = 84/156 (53%), Gaps = 1/156 (0%)
Frame = -3

Query: 466 SMQVTGSVQYAIRQAAEVENYFTSVERINAYAN-LTTEADPNTSPGIVEEGWPSRGEIEF 290
++Q+TG Q+ +R A+E E FTSVERIN Y L+ EA WP GE+ F
Sbjct: 1129 AVQLTGLFQFTVRLASETEARFTSVERINHYIKTLSLEAPARIKNKAPSPDWPQEGEVTF 1188

Query: 289 VKYTMTYRVDLPPVLNNISFKINXXXXXXXXXXXXXXXXXXXXXLFRMVENERCAGDIVI 110
M YR +LP VL +SF I LFR+VE G I I
Sbjct: 1189 ENAEMRYRENLPLVLKKVSFTIKPKEKIGIVGRTGSGKSSLGMALFRLVELS--GGCIKI 1246

Query: 109 DGVNIKSVGLDDLRQRLSIIPQDPILFQGSVRSNLD 2
DGV I +GL DLR +LSIIPQ+P+LF G+VRSNLD
Sbjct: 1247 DGVRISDIGLADLRSKLSIIPQEPVLFSGTVRSNLD 1282