BP918236
Clone id YMU001_000111_B02
Library
Length 541
Definition Adiantum capillus-veneris mRNA. clone: YMU001_000111_B02.
Accession
Tissue type prothallium
Developmental stage -
Contig ID
Sequence
CTCTTCAAAGGCAACTAAATTAATTGGCAAATGATTGCCCAATTAATGATTGTTGAATCA
CATTTGAACAGATTGCAACAATCACGAGAGCCTACGTAGCTCTCCCGTTTCTAAAGCATA
GCGTCCATGTTGTGATAAGACCAGGGCATCATACTGGATATCCTCTTGTGAATAATCAAA
ATGTGGTGCTTTAACTATTGTTTGCAATATCTGTAAAGGATCACCATGACTCACCAACAG
CACTGCTAATCCTTAGCATTCTATTTGTATCTGCTGGATTACTCTAGTTAGCAGCACAGC
AACATCTGCCACGCTTTCCCCACCAATAGGTCCAACCAAAGAATTGTGCTCATCCAATGC
CAATATCTCAGGATAATGCTCATGAGATTTCAGCTCTAAAGCAGGTCCAAAGTATCTCTC
CCGTAGATGCTCTACGCACTTTATTTGAGATGGGTCAAGCTGTACAACTTCAGCCACCGC
CTTTGCTGTATCTATTGTTCTACTAAAAGGTGAGCAATAGATCCGCACCTTATTTGTTCC
T
■■Homology search results ■■ -
sp_hit_id P64956
Definition sp|P64956|Y2253_MYCBO Uncharacterized protein Mb2253c OS=Mycobacterium bovis
Align length 109
Score (bit) 38.9
E-value 0.016
Report
BLASTX 2.2.19 [Nov-02-2008]


Reference: Altschul, Stephen F., Thomas L. Madden, Alejandro A. Schaffer,
Jinghui Zhang, Zheng Zhang, Webb Miller, and David J. Lipman (1997),
"Gapped BLAST and PSI-BLAST: a new generation of protein database search
programs", Nucleic Acids Res. 25:3389-3402.

Query= BP918236|Adiantum capillus-veneris mRNA, clone:
YMU001_000111_B02.
(541 letters)

Database: uniprot_sprot.fasta
412,525 sequences; 148,809,765 total letters

Searching..................................................done



Score E
Sequences producing significant alignments: (bits) Value

sp|P64956|Y2253_MYCBO Uncharacterized protein Mb2253c OS=Mycobac... 39 0.016
sp|P64955|Y2228_MYCTU Uncharacterized protein Rv2228c/MT2287 OS=... 39 0.016
sp|A2C794|PNP_PROM3 Polyribonucleotide nucleotidyltransferase OS... 32 1.5
sp|Q7V606|PNP_PROMM Polyribonucleotide nucleotidyltransferase OS... 32 2.0
sp|Q9C9W0|NAP3_ARATH Non-intrinsic ABC protein 3 OS=Arabidopsis ... 32 2.6
sp|Q6FAN3|METN1_ACIAD Methionine import ATP-binding protein metN... 32 2.6
sp|Q54316|HLYB_TREHY Hemolysin B OS=Treponema hyodysenteriae GN=... 31 4.5
sp|Q63H29|METN1_BACCZ Methionine import ATP-binding protein metN... 30 5.8
sp|Q81IZ6|METN1_BACCR Methionine import ATP-binding protein metN... 30 5.8
sp|Q73F11|METN1_BACC1 Methionine import ATP-binding protein metN... 30 5.8
sp|Q81VM2|METN1_BACAN Methionine import ATP-binding protein metN... 30 5.8
sp|P96495|CARB_THET2 Carbamoyl-phosphate synthase large chain OS... 30 5.8
sp|Q8ELA5|METN4_OCEIH Methionine import ATP-binding protein metN... 30 7.6
sp|Q88RB3|METN2_PSEPK Methionine import ATP-binding protein metN... 30 7.6
sp|Q5SKN1|CARB_THET8 Carbamoyl-phosphate synthase large chain OS... 30 7.6
sp|Q3AM38|PNP_SYNSC Polyribonucleotide nucleotidyltransferase OS... 30 9.9
sp|Q3MBD8|GLYA_ANAVT Serine hydroxymethyltransferase OS=Anabaena... 30 9.9
sp|Q8YMW8|GLYA_ANASP Serine hydroxymethyltransferase OS=Anabaena... 30 9.9
sp|Q1XDF4|CLPC_PORYE ATP-dependent Clp protease ATP-binding subu... 30 9.9
sp|P51332|CLPC_PORPU ATP-dependent Clp protease ATP-binding subu... 30 9.9

>sp|P64956|Y2253_MYCBO Uncharacterized protein Mb2253c
OS=Mycobacterium bovis GN=Mb2253c PE=4 SV=1
Length = 364

Score = 38.9 bits (89), Expect = 0.016
Identities = 34/109 (31%), Positives = 51/109 (46%), Gaps = 3/109 (2%)
Frame = -2

Query: 522 IYCSPFSRTIDTAKAVAEVVQLDPSQIKCVEHLRERYFGPALEL---KSHEHYPEILALD 352
+ SP R DTA A + LD + + L E FG L ++ E PE+
Sbjct: 215 VVSSPLQRAYDTAVTAARALALD---VVVDDDLVETDFGAWEGLTFAEAAERDPELHRRW 271

Query: 351 EHNSLVGPIGGESVADVAVLLTRVIQQIQIEC*GLAVLLVSHGDPLQIL 205
++ + P GGES DV + R +I + G VL+VSH P+++L
Sbjct: 272 LQDTSITPPGGESFDDVLRRVRRGRDRIIVGYEGATVLVVSHVTPIKML 320


>sp|P64955|Y2228_MYCTU Uncharacterized protein Rv2228c/MT2287
OS=Mycobacterium tuberculosis GN=Rv2228c PE=4 SV=1
Length = 364

Score = 38.9 bits (89), Expect = 0.016
Identities = 34/109 (31%), Positives = 51/109 (46%), Gaps = 3/109 (2%)
Frame = -2

Query: 522 IYCSPFSRTIDTAKAVAEVVQLDPSQIKCVEHLRERYFGPALEL---KSHEHYPEILALD 352
+ SP R DTA A + LD + + L E FG L ++ E PE+
Sbjct: 215 VVSSPLQRAYDTAVTAARALALD---VVVDDDLVETDFGAWEGLTFAEAAERDPELHRRW 271

Query: 351 EHNSLVGPIGGESVADVAVLLTRVIQQIQIEC*GLAVLLVSHGDPLQIL 205
++ + P GGES DV + R +I + G VL+VSH P+++L
Sbjct: 272 LQDTSITPPGGESFDDVLRRVRRGRDRIIVGYEGATVLVVSHVTPIKML 320


>sp|A2C794|PNP_PROM3 Polyribonucleotide nucleotidyltransferase
OS=Prochlorococcus marinus (strain MIT 9303) GN=pnp PE=3
SV=1
Length = 721

Score = 32.3 bits (72), Expect = 1.5
Identities = 25/99 (25%), Positives = 42/99 (42%), Gaps = 1/99 (1%)
Frame = -2

Query: 483 KAVAEVV-QLDPSQIKCVEHLRERYFGPALELKSHEHYPEILALDEHNSLVGPIGGESVA 307
K +AE V Q P++I +E + E P L H P +L+ L+G + G
Sbjct: 526 KTIAEAVNQARPARIHILEKMLEAIDAPRTSLSPHA--PRLLSFRIDPELIGTVIGPGGR 583

Query: 306 DVAVLLTRVIQQIQIEC*GLAVLLVSHGDPLQILQTIVK 190
+ + R +I IE G+ + G + Q I++
Sbjct: 584 TIKGITERTNTKIDIEDGGIVTIASHDGAAAEAAQRIIE 622


>sp|Q7V606|PNP_PROMM Polyribonucleotide nucleotidyltransferase
OS=Prochlorococcus marinus (strain MIT 9313) GN=pnp PE=3
SV=1
Length = 723

Score = 32.0 bits (71), Expect = 2.0
Identities = 25/99 (25%), Positives = 42/99 (42%), Gaps = 1/99 (1%)
Frame = -2

Query: 483 KAVAEVV-QLDPSQIKCVEHLRERYFGPALELKSHEHYPEILALDEHNSLVGPIGGESVA 307
K +AE V Q P++I +E + E P L H P +L+ L+G + G
Sbjct: 528 KTIAEAVNQARPARIHILEKMLEAIDAPRTTLSPHA--PRLLSFRIDPELIGTVIGPGGR 585

Query: 306 DVAVLLTRVIQQIQIEC*GLAVLLVSHGDPLQILQTIVK 190
+ + R +I IE G+ + G + Q I++
Sbjct: 586 TIKGITERTNTKIDIEDGGIVTIASHDGAAAEAAQRIIE 624


>sp|Q9C9W0|NAP3_ARATH Non-intrinsic ABC protein 3 OS=Arabidopsis
thaliana GN=NAP3 PE=2 SV=1
Length = 263

Score = 31.6 bits (70), Expect = 2.6
Identities = 18/49 (36%), Positives = 26/49 (53%)
Frame = -2

Query: 372 PEILALDEHNSLVGPIGGESVADVAVLLTRVIQQIQIEC*GLAVLLVSH 226
PE+L LDE S + PI E++ DV V L + G+ ++VSH
Sbjct: 178 PEVLLLDEPTSALDPISTENIEDVIVKLKKQR--------GITTVIVSH 218


>sp|Q6FAN3|METN1_ACIAD Methionine import ATP-binding protein metN 1
OS=Acinetobacter sp. (strain ADP1) GN=metN1 PE=3 SV=1
Length = 356

Score = 31.6 bits (70), Expect = 2.6
Identities = 19/61 (31%), Positives = 36/61 (59%)
Frame = -2

Query: 378 HYPEILALDEHNSLVGPIGGESVADVAVLLTRVIQQIQIEC*GLAVLLVSHGDPLQILQT 199
H+PEIL DE S + P ES + + LL ++ Q++ G+ ++L++H +Q+++
Sbjct: 170 HHPEILLCDEATSALDP---ESTSVILNLLKQINQEL-----GITIVLITH--EMQVIRE 219

Query: 198 I 196
I
Sbjct: 220 I 220


>sp|Q54316|HLYB_TREHY Hemolysin B OS=Treponema hyodysenteriae
GN=tlyB PE=3 SV=1
Length = 828

Score = 30.8 bits (68), Expect = 4.5
Identities = 23/81 (28%), Positives = 38/81 (46%), Gaps = 4/81 (4%)
Frame = -2

Query: 468 VVQLDPSQI----KCVEHLRERYFGPALELKSHEHYPEILALDEHNSLVGPIGGESVADV 301
V+ LD S + K ER LE+K + I+ +DE ++L+G G E D
Sbjct: 248 VLTLDLSSVVAGTKYRGEFEERIKNIVLEIKKASNI--IIFIDELHTLIGAGGAEGALDA 305

Query: 300 AVLLTRVIQQIQIEC*GLAVL 238
A +L + + +I+C G +
Sbjct: 306 ANMLKPALSRGEIQCIGATTI 326


>sp|Q63H29|METN1_BACCZ Methionine import ATP-binding protein metN 1
OS=Bacillus cereus (strain ZK / E33L) GN=metN1 PE=3 SV=1
Length = 346

Score = 30.4 bits (67), Expect = 5.8
Identities = 19/61 (31%), Positives = 34/61 (55%)
Frame = -2

Query: 378 HYPEILALDEHNSLVGPIGGESVADVAVLLTRVIQQIQIEC*GLAVLLVSHGDPLQILQT 199
H PE+L DE S + P +S+ D LL ++ ++I G+ +LL++H + ++Q
Sbjct: 157 HEPEVLLSDEATSALDPETTDSILD---LLLKINEEI-----GITILLITH--EMNVIQR 206

Query: 198 I 196
I
Sbjct: 207 I 207


>sp|Q81IZ6|METN1_BACCR Methionine import ATP-binding protein metN 1
OS=Bacillus cereus (strain ATCC 14579 / DSM 31) GN=metN1
PE=3 SV=1
Length = 346

Score = 30.4 bits (67), Expect = 5.8
Identities = 19/61 (31%), Positives = 34/61 (55%)
Frame = -2

Query: 378 HYPEILALDEHNSLVGPIGGESVADVAVLLTRVIQQIQIEC*GLAVLLVSHGDPLQILQT 199
H PE+L DE S + P +S+ D LL ++ ++I G+ +LL++H + ++Q
Sbjct: 157 HEPEVLLSDEATSALDPETTDSILD---LLLKINEEI-----GITILLITH--EMNVIQR 206

Query: 198 I 196
I
Sbjct: 207 I 207


>sp|Q73F11|METN1_BACC1 Methionine import ATP-binding protein metN 1
OS=Bacillus cereus (strain ATCC 10987) GN=metN1 PE=3
SV=1
Length = 346

Score = 30.4 bits (67), Expect = 5.8
Identities = 19/61 (31%), Positives = 34/61 (55%)
Frame = -2

Query: 378 HYPEILALDEHNSLVGPIGGESVADVAVLLTRVIQQIQIEC*GLAVLLVSHGDPLQILQT 199
H PE+L DE S + P +S+ D LL ++ ++I G+ +LL++H + ++Q
Sbjct: 157 HEPEVLLSDEATSALDPETTDSILD---LLLKINEEI-----GITILLITH--EMNVIQR 206

Query: 198 I 196
I
Sbjct: 207 I 207


tr_hit_id A9SQA8
Definition tr|A9SQA8|A9SQA8_PHYPA Predicted protein OS=Physcomitrella patens subsp. patens
Align length 157
Score (bit) 139.0
E-value 1.0e-31
Report
BLASTX 2.2.19 [Nov-02-2008]


Reference: Altschul, Stephen F., Thomas L. Madden, Alejandro A. Schaffer,
Jinghui Zhang, Zheng Zhang, Webb Miller, and David J. Lipman (1997),
"Gapped BLAST and PSI-BLAST: a new generation of protein database search
programs", Nucleic Acids Res. 25:3389-3402.

Query= BP918236|Adiantum capillus-veneris mRNA, clone:
YMU001_000111_B02.
(541 letters)

Database: uniprot_trembl.fasta
7,341,751 sequences; 2,391,615,440 total letters

Searching..................................................done



Score E
Sequences producing significant alignments: (bits) Value

tr|A9SQA8|A9SQA8_PHYPA Predicted protein OS=Physcomitrella paten... 139 1e-31
tr|Q8LCU4|Q8LCU4_ARATH Putative uncharacterized protein OS=Arabi... 132 1e-29
tr|Q0WW53|Q0WW53_ARATH Putative uncharacterized protein At4g3837... 130 3e-29
tr|A9NTT2|A9NTT2_PICSI Putative uncharacterized protein OS=Picea... 127 4e-28
tr|A7P8P2|A7P8P2_VITVI Chromosome chr3 scaffold_8, whole genome ... 125 1e-27
tr|A5C079|A5C079_VITVI Putative uncharacterized protein OS=Vitis... 125 1e-27
tr|Q7XSW9|Q7XSW9_ORYSJ Os04g0224600 protein OS=Oryza sativa subs... 121 3e-26
tr|Q01MH8|Q01MH8_ORYSA H0515C11.13 protein OS=Oryza sativa GN=H0... 120 5e-26
tr|Q9SVE8|Q9SVE8_ARATH Putative uncharacterized protein F22I13.1... 112 1e-23
tr|B4FCG6|B4FCG6_MAIZE Putative uncharacterized protein OS=Zea m... 105 1e-21
tr|B6UI41|B6UI41_MAIZE Phosphoglycerate mutase family protein OS... 105 2e-21
tr|B6T2P7|B6T2P7_MAIZE Phosphoglycerate mutase family protein OS... 104 3e-21
tr|A8HRE2|A8HRE2_CHLRE Phosphoglycerate mutase OS=Chlamydomonas ... 70 7e-11
tr|A9VC76|A9VC76_MONBE Predicted protein OS=Monosiga brevicollis... 62 1e-08
tr|A3AR92|A3AR92_ORYSJ Putative uncharacterized protein OS=Oryza... 52 3e-05
tr|B2J743|B2J743_NOSP7 Phosphoglycerate mutase OS=Nostoc punctif... 49 2e-04
tr|Q8FN93|Q8FN93_COREF Putative phosphoglycerate mutase OS=Coryn... 47 8e-04
tr|Q47NI3|Q47NI3_THEFY Putative uncharacterized protein OS=Therm... 47 8e-04
tr|Q8NN59|Q8NN59_CORGL Phosphoglycerate mutase/fructose-2,6-bisp... 45 0.002
tr|A4QG71|A4QG71_CORGB Putative uncharacterized protein OS=Coryn... 45 0.002
tr|A9TAW0|A9TAW0_PHYPA Predicted protein OS=Physcomitrella paten... 45 0.002
tr|B6KPR9|B6KPR9_TOXGO Phosphoglycerate mutase, putative OS=Toxo... 45 0.002
tr|B6A9G2|B6A9G2_9CRYT Phosphoglycerate mutase family protein OS... 45 0.002
tr|Q79VE1|Q79VE1_CORGL Phosphoglycerate mutase/fructose-2,6-bisp... 44 0.004
tr|B1WRS1|B1WRS1_CYAA5 Phosphoglycerate mutase OS=Cyanothece (st... 44 0.004
tr|A6WEC3|A6WEC3_KINRD Phosphoglycerate mutase OS=Kineococcus ra... 44 0.004
tr|A4QFU7|A4QFU7_CORGB Putative uncharacterized protein OS=Coryn... 44 0.004
tr|A4T0I6|A4T0I6_POLSQ Phosphoglycerate mutase OS=Polynucleobact... 44 0.007
tr|Q4C310|Q4C310_CROWT Phosphoglycerate/bisphosphoglycerate muta... 44 0.007
tr|Q5CRI8|Q5CRI8_CRYPV Phosphoglycerate mutase family protein; p... 44 0.007

>tr|A9SQA8|A9SQA8_PHYPA Predicted protein OS=Physcomitrella patens
subsp. patens GN=PHYPADRAFT_133404 PE=4 SV=1
Length = 235

Score = 139 bits (349), Expect = 1e-31
Identities = 82/157 (52%), Positives = 105/157 (66%), Gaps = 12/157 (7%)
Frame = -2

Query: 534 NKVRIYCSPFSRTIDTAKAVAE---VVQLDPSQIKCVEHLRERYFGPALELKSHEHYPEI 364
++VRI+ SPFSRT++TAK VA+ V+ IK +E LRERYFGP LEL+SHEHYPEI
Sbjct: 68 DQVRIFASPFSRTLETAKVVADSMGVLMNAKPTIKFLEELRERYFGPPLELQSHEHYPEI 127

Query: 363 LALDEHNSLVGPIGGESVADVAVLLTRVIQQIQIEC*GLAVLLVSHGDPLQILQTIVKA- 187
A+D + LVGP GGESVADVA+ ++ I Q++ E G VL+VSHGD LQILQT+ A
Sbjct: 128 WAIDAIDPLVGPDGGESVADVAIRVSEAIMQMESEVQGCGVLVVSHGDTLQILQTVTYAA 187

Query: 186 -----PHFDYSQEDIQYDAL---VLSQHGRYALETGE 100
D + + DA+ VLS+H Y+L TGE
Sbjct: 188 LATMSSAGDGTLASLFADAITRPVLSRHREYSLLTGE 224


>tr|Q8LCU4|Q8LCU4_ARATH Putative uncharacterized protein
OS=Arabidopsis thaliana PE=2 SV=1
Length = 225

Score = 132 bits (332), Expect = 1e-29
Identities = 79/152 (51%), Positives = 96/152 (63%), Gaps = 7/152 (4%)
Frame = -2

Query: 534 NKVRIYCSPFSRTIDTAKAVAEVVQL--DPSQIKCVEHLRERYFGPALELKSHEHYPEIL 361
+KVRI SPFSRT TA+ VAEV+ L D Q K +E LRERYFGP ELKSH+ YPEI
Sbjct: 69 DKVRICYSPFSRTTHTARVVAEVLNLPFDAPQCKMMEDLRERYFGPTFELKSHDKYPEIW 128

Query: 360 ALDEHNSLVGPIGGESVADVAVLLTRVIQQIQIEC*GLAVLLVSHGDPLQILQTI---VK 190
ALDE + +GP GGES DV L ++ ++ E A+L+VSHGDPLQ+LQ + K
Sbjct: 129 ALDEKDPFMGPEGGESADDVVSRLATAMKSMEAEYQRCAILVVSHGDPLQMLQNVFHSAK 188

Query: 189 APHFDYSQEDIQYD--ALVLSQHGRYALETGE 100
D E Q A VLSQH ++AL TGE
Sbjct: 189 QQEGDGLAEKFQLSRVASVLSQHRKFALLTGE 220


>tr|Q0WW53|Q0WW53_ARATH Putative uncharacterized protein At4g38370
OS=Arabidopsis thaliana GN=At4g38370 PE=2 SV=1
Length = 225

Score = 130 bits (328), Expect = 3e-29
Identities = 78/152 (51%), Positives = 96/152 (63%), Gaps = 7/152 (4%)
Frame = -2

Query: 534 NKVRIYCSPFSRTIDTAKAVAEVVQL--DPSQIKCVEHLRERYFGPALELKSHEHYPEIL 361
+KVRI SPFSRT TA+ VA+V+ L D Q K +E LRERYFGP ELKSH+ YPEI
Sbjct: 69 DKVRICYSPFSRTTHTARVVAKVLNLPFDAPQCKMMEDLRERYFGPTFELKSHDKYPEIW 128

Query: 360 ALDEHNSLVGPIGGESVADVAVLLTRVIQQIQIEC*GLAVLLVSHGDPLQILQTI---VK 190
ALDE + +GP GGES DV L ++ ++ E A+L+VSHGDPLQ+LQ + K
Sbjct: 129 ALDEKDPFMGPEGGESADDVVSRLATAMKSMEAEYQRCAILVVSHGDPLQMLQNVFHSAK 188

Query: 189 APHFDYSQEDIQYD--ALVLSQHGRYALETGE 100
D E Q A VLSQH ++AL TGE
Sbjct: 189 QQEGDGLAEKFQLSRVASVLSQHRKFALLTGE 220


>tr|A9NTT2|A9NTT2_PICSI Putative uncharacterized protein OS=Picea
sitchensis PE=2 SV=1
Length = 252

Score = 127 bits (319), Expect = 4e-28
Identities = 82/180 (45%), Positives = 101/180 (56%), Gaps = 36/180 (20%)
Frame = -2

Query: 531 KVRIYCSPFSRTIDTAKAVAEVVQL--DPSQIKCVEHLRERYFGPALELKSHEHYPEILA 358
KVRIY SPFSRT TA+A ++ L D QIK E LRERYFGP LEL+SH+HY EI A
Sbjct: 68 KVRIYLSPFSRTRQTAEAFTSLLNLPFDSPQIKVTEALRERYFGPRLELQSHDHYTEIWA 127

Query: 357 LDEHNSLVGPIGGESVADVAVLLTRVIQQIQIEC-------------------------* 253
LDE + P GGESVADVA L+ ++ + EC
Sbjct: 128 LDERDPFAPPEGGESVADVASRLSTILAMTEAECEGTTIDLKVYAAQQHLGGIPNTLAWF 187

Query: 252 GLAVLLVSHGDPLQILQTIVKAPHFDYSQE-----DIQYDAL----VLSQHGRYALETGE 100
G A+LLV+HGDPLQI QTI+ A +S E D A+ +LSQH +++L TGE
Sbjct: 188 GYAILLVAHGDPLQIFQTILHATLDSHSCEKNGILDANLGAVMSAPILSQHRKFSLFTGE 247


>tr|A7P8P2|A7P8P2_VITVI Chromosome chr3 scaffold_8, whole genome
shotgun sequence OS=Vitis vinifera GN=GSVIVT00036253001
PE=4 SV=1
Length = 227

Score = 125 bits (314), Expect = 1e-27
Identities = 76/153 (49%), Positives = 94/153 (61%), Gaps = 10/153 (6%)
Frame = -2

Query: 528 VRIYCSPFSRTIDTAKAVAEVVQL--DPSQIKCVEHLRERYFGPALELKSHEHYPEILAL 355
VRI SPFSRT TAK VA V+ L Q K ++ LRER+FGP+ EL SH+ YPEI AL
Sbjct: 70 VRICYSPFSRTTHTAKVVASVLDLPFQGPQCKVLDDLRERFFGPSFELMSHDKYPEIWAL 129

Query: 354 DEHNSLVGPIGGESVADVAVLLTRVIQQIQIEC*GLAVLLVSHGDPLQILQTIVKAPHFD 175
DE + P GGES ADVA L + ++ E G A+L+VSHGDPLQILQTI+ A D
Sbjct: 130 DEKDPFTRPEGGESAADVACRLAHAMATMESEFQGCAILVVSHGDPLQILQTILNAVKED 189

Query: 174 --------YSQEDIQYDALVLSQHGRYALETGE 100
S+ + +LSQH ++AL TGE
Sbjct: 190 REPRSNDLASRIEAVRVPSILSQHRKFALLTGE 222


>tr|A5C079|A5C079_VITVI Putative uncharacterized protein OS=Vitis
vinifera GN=VITISV_002890 PE=4 SV=1
Length = 227

Score = 125 bits (314), Expect = 1e-27
Identities = 76/153 (49%), Positives = 95/153 (62%), Gaps = 10/153 (6%)
Frame = -2

Query: 528 VRIYCSPFSRTIDTAKAVAEVVQL--DPSQIKCVEHLRERYFGPALELKSHEHYPEILAL 355
VRI SPFSRT TAK VA V+ L + Q K ++ LRER+FGP+ EL SH+ YPEI AL
Sbjct: 70 VRICYSPFSRTTHTAKVVASVLDLPFEGPQCKVLDDLRERFFGPSFELMSHDKYPEIWAL 129

Query: 354 DEHNSLVGPIGGESVADVAVLLTRVIQQIQIEC*GLAVLLVSHGDPLQILQTIVKAPHFD 175
DE + P GGES ADVA L + ++ E G A+L+VSHGDPLQILQTI+ A D
Sbjct: 130 DEKDPFTRPEGGESAADVAGRLAHAMATMESEFQGCAILVVSHGDPLQILQTILNAVKED 189

Query: 174 --------YSQEDIQYDALVLSQHGRYALETGE 100
S+ + +LSQH ++AL TGE
Sbjct: 190 REPRSNDLASRIEAVRVPSILSQHRKFALLTGE 222


>tr|Q7XSW9|Q7XSW9_ORYSJ Os04g0224600 protein OS=Oryza sativa subsp.
japonica GN=OSJNBb0072N21.7 PE=4 SV=2
Length = 236

Score = 121 bits (303), Expect = 3e-26
Identities = 75/156 (48%), Positives = 99/156 (63%), Gaps = 11/156 (7%)
Frame = -2

Query: 534 NKVRIYCSPFSRTIDTAKAVAEVVQLD---PSQIKCVEHLRERYFGPALELKSHEHYPEI 364
+ V+I SPFSRT++TA+ VA V+ + PS I VE LRERYFGP+ EL SHE Y E+
Sbjct: 77 DSVQIRYSPFSRTMETAREVARVLGVPFDTPSCIPAVE-LRERYFGPSHELLSHEKYAEV 135

Query: 363 LALDEHNSLVGPIGGESVADVAVLLTRVIQQIQIEC*GLAVLLVSHGDPLQILQTIVKAP 184
A+DE + L+ P GGESVADVA ++ + ++E G A+L+VSHGDPLQI Q ++K
Sbjct: 136 WAVDEVDPLMAPDGGESVADVATRFSQFLSAAEMELHGSAILIVSHGDPLQIFQAVLKET 195

Query: 183 HFDYSQEDIQYD--------ALVLSQHGRYALETGE 100
+ S D D VLSQH ++AL TGE
Sbjct: 196 KENPSSLDEVSDLKKRGMITLSVLSQHRQFALLTGE 231


>tr|Q01MH8|Q01MH8_ORYSA H0515C11.13 protein OS=Oryza sativa
GN=H0515C11.13 PE=4 SV=1
Length = 236

Score = 120 bits (301), Expect = 5e-26
Identities = 74/156 (47%), Positives = 99/156 (63%), Gaps = 11/156 (7%)
Frame = -2

Query: 534 NKVRIYCSPFSRTIDTAKAVAEVVQL---DPSQIKCVEHLRERYFGPALELKSHEHYPEI 364
+ V+I SPFSRT++TA+ VA ++ + PS I VE LRERYFGP+ EL SHE Y E+
Sbjct: 77 DSVQIRYSPFSRTMETAREVARMLGVPFDSPSCIPAVE-LRERYFGPSHELLSHEKYAEV 135

Query: 363 LALDEHNSLVGPIGGESVADVAVLLTRVIQQIQIEC*GLAVLLVSHGDPLQILQTIVKAP 184
A+DE + L+ P GGESVADVA ++ + ++E G A+L+VSHGDPLQI Q ++K
Sbjct: 136 WAVDEVDPLMAPDGGESVADVATRFSQFLSAAEMELHGSAILIVSHGDPLQIFQAVLKET 195

Query: 183 HFDYSQEDIQYD--------ALVLSQHGRYALETGE 100
+ S D D VLSQH ++AL TGE
Sbjct: 196 KENPSSLDEVSDLKKRGMITLSVLSQHRQFALLTGE 231


>tr|Q9SVE8|Q9SVE8_ARATH Putative uncharacterized protein F22I13.140
(Putative uncharacterized protein AT4g38370)
OS=Arabidopsis thaliana GN=F22I13.140 PE=2 SV=1
Length = 261

Score = 112 bits (281), Expect = 1e-23
Identities = 76/188 (40%), Positives = 95/188 (50%), Gaps = 43/188 (22%)
Frame = -2

Query: 534 NKVRIYCSPFSRTIDTAKAVAEVVQLDPSQIKC--------------------------- 436
+KVRI SPFSRT TA+ VA+V+ L +C
Sbjct: 69 DKVRICYSPFSRTTHTARVVAKVLNLPFDAPQCKVDIRVPKGCSFMHPTYFYICSNLCLS 128

Query: 435 -----------VEHLRERYFGPALELKSHEHYPEILALDEHNSLVGPIGGESVADVAVLL 289
+E LRERYFGP ELKSH+ YPEI ALDE + +GP GGES DV L
Sbjct: 129 VIQRLFLAEQMMEDLRERYFGPTFELKSHDKYPEIWALDEKDPFMGPEGGESADDVVSRL 188

Query: 288 TRVIQQIQIEC*GLAVLLVSHGDPLQILQTI---VKAPHFDYSQEDIQYD--ALVLSQHG 124
++ ++ E A+L+VSHGDPLQ+LQ + K D E Q A VLSQH
Sbjct: 189 ATAMKSMEAEYQRCAILVVSHGDPLQMLQNVFHSAKQQEGDGLAEKFQLSRVASVLSQHR 248

Query: 123 RYALETGE 100
++AL TGE
Sbjct: 249 KFALLTGE 256


>tr|B4FCG6|B4FCG6_MAIZE Putative uncharacterized protein OS=Zea mays
PE=2 SV=1
Length = 245

Score = 105 bits (263), Expect = 1e-21
Identities = 66/164 (40%), Positives = 92/164 (56%), Gaps = 21/164 (12%)
Frame = -2

Query: 528 VRIYCSPFSRTIDTAKAVAEV--VQLDPSQIKCVEHLRERYFGPALELKSHEHYPEILAL 355
V+I SPFSRT +TA+ VA V + + + V LRERYFGP+ EL SH+ Y +I ++
Sbjct: 77 VKIRYSPFSRTTETARVVAGVLGIPFEAPSCEAVLGLRERYFGPSYELLSHDKYADIWSV 136

Query: 354 DEHNSLVGPIGGESVADVAVLLTRVIQQIQIEC*GLAVLLVSHGDPLQILQTIVKAPHFD 175
DE + + P GGESVADVA + V+ + + G A+L+VSHGDPLQI Q ++ +
Sbjct: 137 DEAHPCMAPEGGESVADVASRFSAVLLSAETQFHGSAILIVSHGDPLQIFQAVLSGAKEN 196

Query: 174 YSQEDIQYD-------------------ALVLSQHGRYALETGE 100
S D + A +LSQH ++AL TGE
Sbjct: 197 MSFLDDLTNLKVKDTDDLTNLEVKDTMVASILSQHRKFALITGE 240