BP918265
Clone id YMU001_000111_D12
Library
Length 483
Definition Adiantum capillus-veneris mRNA. clone: YMU001_000111_D12.
Accession
Tissue type prothallium
Developmental stage -
Contig ID -
Sequence
GGTAACGTGGCCTTTATTGAGGTTACCTCTTAACAAGGTAACATAATAGTAATGCGTTGG
ACTTACAGTCCTGGAATGATGGTTTGACTCCATCCCCAGTTTTTCTTACAAAAGTGTGGT
TTGGTCGAGGGTCTGCCTTCCTTCCTTTCCCTTCACCTCGGCAGTGGAAAAGGGCAAAGT
GAACCCACTGTGACATAACAGTACATAGCAGGGGACCCTACCTTAGAATGCAATGGGTGT
ATGTAGGTTCCCTCCAGCTACCTATTTATTTTATTAGGGACTTGGACATGCAAAAAGGAT
GCTCTGTTGCTAGTCAAAGTTGGCATGGAGCTGCTGCCTTAATAGGAGCTGCCGCCAAAG
CTACTTTAACTAACTCCACCCTAGCATTTGCCACCAGTTTGTGTCTCCTCACGCTTCATC
TTGTAGGCACATGCTGTCTCTGGCAATCAATGGTCTAAGATTGCCTCTTTTCTTTTCTAT
TAT
■■Homology search results ■■ -
sp_hit_id Q4JL76
Definition sp|Q4JL76|MYBA2_ORYSJ Myb-related protein MYBAS2 OS=Oryza sativa subsp. japonica
Align length 23
Score (bit) 25.0
E-value 2.7
Report
BLASTX 2.2.19 [Nov-02-2008]


Reference: Altschul, Stephen F., Thomas L. Madden, Alejandro A. Schaffer,
Jinghui Zhang, Zheng Zhang, Webb Miller, and David J. Lipman (1997),
"Gapped BLAST and PSI-BLAST: a new generation of protein database search
programs", Nucleic Acids Res. 25:3389-3402.

Query= BP918265|Adiantum capillus-veneris mRNA, clone:
YMU001_000111_D12.
(483 letters)

Database: uniprot_sprot.fasta
412,525 sequences; 148,809,765 total letters

Searching..................................................done



Score E
Sequences producing significant alignments: (bits) Value

sp|Q4JL76|MYBA2_ORYSJ Myb-related protein MYBAS2 OS=Oryza sativa... 25 2.7
sp|O81283|TC159_ARATH Translocase of chloroplast 159, chloroplas... 31 3.4
sp|Q971T7|RGYR1_SULTO Reverse gyrase 1 OS=Sulfolobus tokodaii GN... 29 9.8
sp|P63319|KPCG_RAT Protein kinase C gamma type OS=Rattus norvegi... 29 9.8
sp|P10829|KPCG_RABIT Protein kinase C gamma type OS=Oryctolagus ... 29 9.8
sp|P63318|KPCG_MOUSE Protein kinase C gamma type OS=Mus musculus... 29 9.8
sp|Q4R4U2|KPCG_MACFA Protein kinase C gamma type OS=Macaca fasci... 29 9.8
sp|P05129|KPCG_HUMAN Protein kinase C gamma type OS=Homo sapiens... 29 9.8
sp|P05128|KPCG_BOVIN Protein kinase C gamma type (Fragment) OS=B... 29 9.8

>sp|Q4JL76|MYBA2_ORYSJ Myb-related protein MYBAS2 OS=Oryza sativa
subsp. japonica GN=MYBAS2 PE=2 SV=1
Length = 242

Score = 25.0 bits (53), Expect(2) = 2.7
Identities = 10/23 (43%), Positives = 14/23 (60%)
Frame = +2

Query: 344 RSCRQSYFN*LHPSICHQFVSPH 412
+SCR + N LHP + +SPH
Sbjct: 47 KSCRLRWVNYLHPGLKRGRMSPH 69



Score = 24.6 bits (52), Expect(2) = 2.7
Identities = 11/18 (61%), Positives = 13/18 (72%)
Frame = +1

Query: 412 RFIL*AHAVSGNQWSKIA 465
R IL HA GN+WS+IA
Sbjct: 72 RLILELHARWGNRWSRIA 89


>sp|O81283|TC159_ARATH Translocase of chloroplast 159, chloroplastic
OS=Arabidopsis thaliana GN=TOC159 PE=1 SV=1
Length = 1503

Score = 30.8 bits (68), Expect = 3.4
Identities = 16/33 (48%), Positives = 20/33 (60%), Gaps = 2/33 (6%)
Frame = -3

Query: 121 NHTFVRKTGDGVK--PSFQDCKSNALLLCYLVK 29
NH RK +GVK P+ Q +S LLLCY +K
Sbjct: 1036 NHPLCRKNREGVKVLPNGQTWRSQLLLLCYSLK 1068


>sp|Q971T7|RGYR1_SULTO Reverse gyrase 1 OS=Sulfolobus tokodaii GN=rgy1
PE=1 SV=1
Length = 1156

Score = 29.3 bits (64), Expect = 9.8
Identities = 21/62 (33%), Positives = 33/62 (53%), Gaps = 5/62 (8%)
Frame = -2

Query: 293 LHVQVPNKINR*LEGTYIHPLHSKVGSPAMYCYVTVGSLCPF-----PLPR*RERKEGRP 129
L V++P KI+ + I+PL + V S Y+T GS+ P + +E++ GRP
Sbjct: 1003 LEVELPTKISGGF--SIIYPLKTYVVSEKYSTYLTKGSIIPLFTYAEIIKNMKEKEIGRP 1060

Query: 128 ST 123
ST
Sbjct: 1061 ST 1062


>sp|P63319|KPCG_RAT Protein kinase C gamma type OS=Rattus norvegicus
GN=Prkcg PE=1 SV=1
Length = 697

Score = 29.3 bits (64), Expect = 9.8
Identities = 22/61 (36%), Positives = 29/61 (47%), Gaps = 12/61 (19%)
Frame = -3

Query: 256 WREPTY-THCI-----LR*GPLLCTVMSQWVH-----FALFHCRGEGKGRKA-DPRPNHT 113
+++PT+ +HC + L C V S VH F F C G GKG + DPR H
Sbjct: 43 FKQPTFCSHCTDFIWGIGKQGLQCQVCSFVVHRRCHEFVTFECPGAGKGPQTDDPRNKHK 102

Query: 112 F 110
F
Sbjct: 103 F 103


>sp|P10829|KPCG_RABIT Protein kinase C gamma type OS=Oryctolagus
cuniculus GN=PRKCG PE=2 SV=1
Length = 697

Score = 29.3 bits (64), Expect = 9.8
Identities = 22/61 (36%), Positives = 29/61 (47%), Gaps = 12/61 (19%)
Frame = -3

Query: 256 WREPTY-THCI-----LR*GPLLCTVMSQWVH-----FALFHCRGEGKGRKA-DPRPNHT 113
+++PT+ +HC + L C V S VH F F C G GKG + DPR H
Sbjct: 43 FKQPTFCSHCTDFIWGIGKQGLQCQVCSFVVHRRCHEFVTFECPGAGKGPQTDDPRNKHK 102

Query: 112 F 110
F
Sbjct: 103 F 103


>sp|P63318|KPCG_MOUSE Protein kinase C gamma type OS=Mus musculus
GN=Prkcg PE=1 SV=1
Length = 697

Score = 29.3 bits (64), Expect = 9.8
Identities = 22/61 (36%), Positives = 29/61 (47%), Gaps = 12/61 (19%)
Frame = -3

Query: 256 WREPTY-THCI-----LR*GPLLCTVMSQWVH-----FALFHCRGEGKGRKA-DPRPNHT 113
+++PT+ +HC + L C V S VH F F C G GKG + DPR H
Sbjct: 43 FKQPTFCSHCTDFIWGIGKQGLQCQVCSFVVHRRCHEFVTFECPGAGKGPQTDDPRNKHK 102

Query: 112 F 110
F
Sbjct: 103 F 103


>sp|Q4R4U2|KPCG_MACFA Protein kinase C gamma type OS=Macaca
fascicularis GN=PRKCG PE=2 SV=1
Length = 697

Score = 29.3 bits (64), Expect = 9.8
Identities = 22/61 (36%), Positives = 29/61 (47%), Gaps = 12/61 (19%)
Frame = -3

Query: 256 WREPTY-THCI-----LR*GPLLCTVMSQWVH-----FALFHCRGEGKGRKA-DPRPNHT 113
+++PT+ +HC + L C V S VH F F C G GKG + DPR H
Sbjct: 43 FKQPTFCSHCTDFIWGIGKQGLQCQVCSFVVHRRCHEFVTFECPGAGKGPQTDDPRNKHK 102

Query: 112 F 110
F
Sbjct: 103 F 103


>sp|P05129|KPCG_HUMAN Protein kinase C gamma type OS=Homo sapiens
GN=PRKCG PE=1 SV=3
Length = 697

Score = 29.3 bits (64), Expect = 9.8
Identities = 22/61 (36%), Positives = 29/61 (47%), Gaps = 12/61 (19%)
Frame = -3

Query: 256 WREPTY-THCI-----LR*GPLLCTVMSQWVH-----FALFHCRGEGKGRKA-DPRPNHT 113
+++PT+ +HC + L C V S VH F F C G GKG + DPR H
Sbjct: 43 FKQPTFCSHCTDFIWGIGKQGLQCQVCSFVVHRRCHEFVTFECPGAGKGPQTDDPRNKHK 102

Query: 112 F 110
F
Sbjct: 103 F 103


>sp|P05128|KPCG_BOVIN Protein kinase C gamma type (Fragment) OS=Bos
taurus GN=PRKCG PE=2 SV=1
Length = 682

Score = 29.3 bits (64), Expect = 9.8
Identities = 22/61 (36%), Positives = 29/61 (47%), Gaps = 12/61 (19%)
Frame = -3

Query: 256 WREPTY-THCI-----LR*GPLLCTVMSQWVH-----FALFHCRGEGKGRKA-DPRPNHT 113
+++PT+ +HC + L C V S VH F F C G GKG + DPR H
Sbjct: 28 FKQPTFCSHCTDFIWGIGKQGLQCQVCSFVVHRRCHEFVTFECPGAGKGPQTDDPRNKHK 87

Query: 112 F 110
F
Sbjct: 88 F 88


tr_hit_id Q25474
Definition tr|Q25474|Q25474_MOLOC Leucine zipper protein OS=Molgula oculata
Align length 58
Score (bit) 33.9
E-value 4.1
Report
BLASTX 2.2.19 [Nov-02-2008]


Reference: Altschul, Stephen F., Thomas L. Madden, Alejandro A. Schaffer,
Jinghui Zhang, Zheng Zhang, Webb Miller, and David J. Lipman (1997),
"Gapped BLAST and PSI-BLAST: a new generation of protein database search
programs", Nucleic Acids Res. 25:3389-3402.

Query= BP918265|Adiantum capillus-veneris mRNA, clone:
YMU001_000111_D12.
(483 letters)

Database: uniprot_trembl.fasta
7,341,751 sequences; 2,391,615,440 total letters

Searching..................................................done



Score E
Sequences producing significant alignments: (bits) Value

tr|Q25474|Q25474_MOLOC Leucine zipper protein OS=Molgula oculata... 34 4.1
tr|B5VWB5|B5VWB5_SPIMA Transposase, IS605 OrfB family OS=Arthros... 34 4.1

>tr|Q25474|Q25474_MOLOC Leucine zipper protein OS=Molgula oculata
GN=Uro-2 PE=2 SV=1
Length = 364

Score = 33.9 bits (76), Expect = 4.1
Identities = 20/58 (34%), Positives = 30/58 (51%)
Frame = -1

Query: 198 LCHSGFTLPFSTAEVKGKEGRQTLDQTTLL*EKLGMESNHHSRTVSPTHYYYVTLLRG 25
LC++ F +PF T + + +++D L KL E H +SP H Y TL+RG
Sbjct: 254 LCNTAFIVPFQTKSMAIRSLTRSMDFIFRLDRKLRDEDLLHK--LSPLHLEYATLMRG 309


>tr|B5VWB5|B5VWB5_SPIMA Transposase, IS605 OrfB family
OS=Arthrospira maxima CS-328 GN=AmaxDRAFT_0807 PE=4 SV=1
Length = 437

Score = 33.9 bits (76), Expect = 4.1
Identities = 18/66 (27%), Positives = 30/66 (45%)
Frame = +3

Query: 111 KVWFGRGSAFLPFPSPRQWKRAK*THCDITVHSRGPYLRMQWVYVGSLQLPIYFIRDLDM 290
KVWF FLPFPS W++ + ++ + R Y W+ +P+ LD
Sbjct: 141 KVWFDLPEIFLPFPSNLDWEKVR----EVQIVPRAGYFDAVWICEAPPVVPVV----LDP 192

Query: 291 QKGCSV 308
+K ++
Sbjct: 193 EKSLAI 198