BP918282
Clone id YMU001_000111_F06
Library
Length 420
Definition Adiantum capillus-veneris mRNA. clone: YMU001_000111_F06.
Accession
Tissue type prothallium
Developmental stage -
Contig ID
Sequence
TTTTTTTTAAGTGGCTCTTCTGCAAAACCTTTAATTTCAGTGTTGCTAGTTACAAAAGAT
GTACAATGGGGGTTAAATATTAATCTTCAATCTAATAGTCGCATGAAAAGTGGACAGACT
TCTCGAAGCCCATCGACCTTATTTGGAAGTTCCAACACTAAAAAAAATGTCTATGTATAG
AAAGAGCACCCATTCGGATTGGCAAAAAACCGACGTGCTCTGCACCTCGGGCACCTGAGC
TTGGGGCAGGGACGTCACGTGCTAATTGCAAAGCTGTGCACATAGACTTTCCAAAACACT
ATTTGATTGATTAGCTGCTGTTAGAGTGGTCTGGTTGTTACTTACACATGTAACCTGCAA
TGTGTCTCCAGTTTGGACCGTAGTGCAAGATGCAACACCTGCATCATCACAATTCCATCT
■■Homology search results ■■ -
sp_hit_id -
Definition No hits.
Align length -
Score (bit) -
E-value -
Report
BLASTX 2.2.19 [Nov-02-2008]


Reference: Altschul, Stephen F., Thomas L. Madden, Alejandro A. Schaffer,
Jinghui Zhang, Zheng Zhang, Webb Miller, and David J. Lipman (1997),
"Gapped BLAST and PSI-BLAST: a new generation of protein database search
programs", Nucleic Acids Res. 25:3389-3402.

Query= BP918282|Adiantum capillus-veneris mRNA, clone:
YMU001_000111_F06.
(420 letters)

Database: uniprot_sprot.fasta
412,525 sequences; 148,809,765 total letters

Searching..................................................done

***** No hits found ******


tr_hit_id Q9M348
Definition tr|Q9M348|Q9M348_ARATH Putative uncharacterized protein F5K20_80 OS=Arabidopsis thaliana
Align length 52
Score (bit) 46.6
E-value 0.0006
Report
BLASTX 2.2.19 [Nov-02-2008]


Reference: Altschul, Stephen F., Thomas L. Madden, Alejandro A. Schaffer,
Jinghui Zhang, Zheng Zhang, Webb Miller, and David J. Lipman (1997),
"Gapped BLAST and PSI-BLAST: a new generation of protein database search
programs", Nucleic Acids Res. 25:3389-3402.

Query= BP918282|Adiantum capillus-veneris mRNA, clone:
YMU001_000111_F06.
(420 letters)

Database: uniprot_trembl.fasta
7,341,751 sequences; 2,391,615,440 total letters

Searching..................................................done



Score E
Sequences producing significant alignments: (bits) Value

tr|Q9M348|Q9M348_ARATH Putative uncharacterized protein F5K20_80... 47 6e-04
tr|Q3EAK1|Q3EAK1_ARATH Uncharacterized protein At3g53780.1 (At3g... 47 6e-04
tr|Q2PEU6|Q2PEU6_TRIPR Putative uncharacterized protein OS=Trifo... 42 0.015
tr|A7PNN3|A7PNN3_VITVI Chromosome chr8 scaffold_23, whole genome... 40 0.057
tr|A7NYY8|A7NYY8_VITVI Chromosome chr6 scaffold_3, whole genome ... 38 0.22
tr|A5ATD5|A5ATD5_VITVI Putative uncharacterized protein OS=Vitis... 37 0.49
tr|Q29IW7|Q29IW7_DROPS GA13130 OS=Drosophila pseudoobscura pseud... 36 1.1
tr|B4GTS5|B4GTS5_DROPE GL14216 OS=Drosophila persimilis GN=GL142... 36 1.1
tr|Q53MA5|Q53MA5_ORYSJ Os11g0704800 protein OS=Oryza sativa subs... 35 1.8
tr|A9RDY0|A9RDY0_PHYPA Predicted protein OS=Physcomitrella paten... 33 7.0
tr|A7SHX3|A7SHX3_NEMVE Predicted protein OS=Nematostella vectens... 33 9.2

>tr|Q9M348|Q9M348_ARATH Putative uncharacterized protein F5K20_80
OS=Arabidopsis thaliana GN=F5K20_80 PE=4 SV=1
Length = 361

Score = 46.6 bits (109), Expect = 6e-04
Identities = 23/52 (44%), Positives = 34/52 (65%), Gaps = 1/52 (1%)
Frame = -1

Query: 420 RWNCDDAGVASCTTVQTGDTLQVTCVSNNQT-TLTAANQSNSVLESLCAQLC 268
+W+C+ ASCTT Q G+ L +TC+ N ++ + AN S+S + SLC QLC
Sbjct: 310 KWSCNREP-ASCTTTQLGNQLSMTCLRNGKSASYILANPSDSRINSLCVQLC 360


>tr|Q3EAK1|Q3EAK1_ARATH Uncharacterized protein At3g53780.1
(At3g53780) OS=Arabidopsis thaliana GN=At3g53780 PE=2
SV=1
Length = 270

Score = 46.6 bits (109), Expect = 6e-04
Identities = 23/52 (44%), Positives = 34/52 (65%), Gaps = 1/52 (1%)
Frame = -1

Query: 420 RWNCDDAGVASCTTVQTGDTLQVTCVSNNQT-TLTAANQSNSVLESLCAQLC 268
+W+C+ ASCTT Q G+ L +TC+ N ++ + AN S+S + SLC QLC
Sbjct: 219 KWSCNREP-ASCTTTQLGNQLSMTCLRNGKSASYILANPSDSRINSLCVQLC 269


>tr|Q2PEU6|Q2PEU6_TRIPR Putative uncharacterized protein
OS=Trifolium pratense PE=2 SV=1
Length = 184

Score = 42.0 bits (97), Expect = 0.015
Identities = 22/53 (41%), Positives = 31/53 (58%), Gaps = 1/53 (1%)
Frame = -1

Query: 420 RWNCDDAGVASCTTVQTGDTLQVTCVSNNQ-TTLTAANQSNSVLESLCAQLCN 265
+W+C A C + Q G+ L VTC SN + TT + S+S ++ LC QLCN
Sbjct: 133 KWSCHTEP-AYCLSNQLGNQLNVTCSSNGKSTTYLMQDPSSSQIQQLCTQLCN 184


>tr|A7PNN3|A7PNN3_VITVI Chromosome chr8 scaffold_23, whole genome
shotgun sequence OS=Vitis vinifera GN=GSVIVT00021327001
PE=4 SV=1
Length = 388

Score = 40.0 bits (92), Expect = 0.057
Identities = 19/53 (35%), Positives = 34/53 (64%), Gaps = 1/53 (1%)
Frame = -1

Query: 420 RWNCDDAGVASCTTVQTGDTLQVTCVSNNQTTL-TAANQSNSVLESLCAQLCN 265
+W+C A C + Q G+ L +TC SN ++++ A+ ++S ++ LC+QLCN
Sbjct: 337 KWSCKTEP-AYCLSNQIGNQLNLTCSSNGKSSIYLLADPTSSQIQGLCSQLCN 388


>tr|A7NYY8|A7NYY8_VITVI Chromosome chr6 scaffold_3, whole genome
shotgun sequence OS=Vitis vinifera GN=GSVIVT00024303001
PE=4 SV=1
Length = 391

Score = 38.1 bits (87), Expect = 0.22
Identities = 18/53 (33%), Positives = 30/53 (56%), Gaps = 1/53 (1%)
Frame = -1

Query: 420 RWNCDDAGVASCTTVQTGDTLQVTCVSNNQTTLTAANQSN-SVLESLCAQLCN 265
+W+C V C + G+ L +TC+SN ++ + N S ++ LC+QLCN
Sbjct: 340 KWSCKSQQVY-CESTTIGNQLNLTCLSNGRSNIYLLPDDNTSQVQQLCSQLCN 391


>tr|A5ATD5|A5ATD5_VITVI Putative uncharacterized protein OS=Vitis
vinifera GN=VITISV_021082 PE=4 SV=1
Length = 391

Score = 37.0 bits (84), Expect = 0.49
Identities = 17/53 (32%), Positives = 30/53 (56%), Gaps = 1/53 (1%)
Frame = -1

Query: 420 RWNCDDAGVASCTTVQTGDTLQVTCVSNNQTTL-TAANQSNSVLESLCAQLCN 265
+W+C V C + G+ L +TC+SN ++ + + S ++ LC+QLCN
Sbjct: 340 KWSCKSQQVY-CESTTIGNQLNLTCLSNGRSNIYLLPDDXTSQVQQLCSQLCN 391


>tr|Q29IW7|Q29IW7_DROPS GA13130 OS=Drosophila pseudoobscura
pseudoobscura GN=GA13130 PE=4 SV=2
Length = 274

Score = 35.8 bits (81), Expect = 1.1
Identities = 23/67 (34%), Positives = 38/67 (56%)
Frame = -1

Query: 342 SNNQTTLTAANQSNSVLESLCAQLCN*HVTSLPQAQVPEVQSTSVFCQSEWVLFLYIDIF 163
S N+T+ TA N+S + ES A++ N T L A++ E Q ++ + W +L DI+
Sbjct: 183 SGNRTSDTAENESGN--ESTSAEVTNEQPTEL--AELAEAQGSTTTVRGHWNKWLSNDIY 238

Query: 162 FSVGTSK 142
SVG ++
Sbjct: 239 LSVGITR 245


>tr|B4GTS5|B4GTS5_DROPE GL14216 OS=Drosophila persimilis GN=GL14216
PE=4 SV=1
Length = 211

Score = 35.8 bits (81), Expect = 1.1
Identities = 23/67 (34%), Positives = 38/67 (56%)
Frame = -1

Query: 342 SNNQTTLTAANQSNSVLESLCAQLCN*HVTSLPQAQVPEVQSTSVFCQSEWVLFLYIDIF 163
S N+T+ TA N+S + ES A++ N T L A++ E Q ++ + W +L DI+
Sbjct: 120 SGNRTSDTAENESGN--ESTSAEVTNEQPTEL--AELAEAQGSTTTVRGHWNKWLSNDIY 175

Query: 162 FSVGTSK 142
SVG ++
Sbjct: 176 LSVGITR 182


>tr|Q53MA5|Q53MA5_ORYSJ Os11g0704800 protein OS=Oryza sativa subsp.
japonica GN=Os11g0704800 PE=4 SV=1
Length = 374

Score = 35.0 bits (79), Expect = 1.8
Identities = 17/53 (32%), Positives = 27/53 (50%), Gaps = 1/53 (1%)
Frame = -1

Query: 420 RWNCDDAGVASCTTVQTGDTLQVTCVSNN-QTTLTAANQSNSVLESLCAQLCN 265
RW C+ + CT +Q +TL +TC N + A+ + + LC QLC+
Sbjct: 323 RWKCNSSPTY-CTVMQQANTLNLTCEGTNVHRSYLIADATQDKINQLCNQLCS 374


>tr|A9RDY0|A9RDY0_PHYPA Predicted protein OS=Physcomitrella patens
subsp. patens GN=PHYPADRAFT_112234 PE=4 SV=1
Length = 340

Score = 33.1 bits (74), Expect = 7.0
Identities = 16/53 (30%), Positives = 24/53 (45%), Gaps = 3/53 (5%)
Frame = -1

Query: 417 WNCDDAGVASCTTVQTGDTLQVTCVSN---NQTTLTAANQSNSVLESLCAQLC 268
W C C G L+VTC S + +T+ AN+ S ++ LC + C
Sbjct: 287 WKCSGDRHLGCNLSSVGSGLRVTCASGQYFDYSTVRYANKLTSEIQGLCIKAC 339