BP918289
Clone id YMU001_000111_G02
Library
Length 538
Definition Adiantum capillus-veneris mRNA. clone: YMU001_000111_G02.
Accession
Tissue type prothallium
Developmental stage -
Contig ID -
Sequence
AATTCGCGGCCGCAAATTCTTCCAGTTTTTTTTTTTTTTTTTTTTTGATAGTAATGTGCA
GAGACATTCACTACAATTGACCTGTCATCGCCCTTTTAATCAGACAGGAATGTTGCTTAC
ATTGTTATATTGCATTGCAGAACAAGGTCTATGTGCTCCTTTTATGGTGTTTTCTTATTG
GGGCTGCCATGCTTGCTGGGAGATAAATGGAAAGGAATAGGCCAACATCACTTGTCCAGA
GATGTGCAAGGAACAAGACCCAAATTAATGAGCAGAAAGAAGATGAAGATCTACAGACTC
AACAAGCTCTATGTAAGACTTGATGAGCTTAGCAAAAAGTTGTTCCTTCTTTGAGGATTC
TTGGGATTGTTCCTATGACATTAAAAACTTCTCTTCTCTTCCCTTCTTCTCGTGCATACA
CTGAACCCGGTTTTTTCGAGTGCTGCCCTTTATATAATGAAAACAATACCTTTCTGCTGC
ACTATTAAGCACCCAAATATATGTGATCAGGAACTGCTGCTTTAATTCCTTTGCTACT
■■Homology search results ■■ -
sp_hit_id Q8BGK2
Definition sp|Q8BGK2|ARHL1_MOUSE [Protein ADP-ribosylarginine] hydrolase-like protein 1 OS=Mus musculus
Align length 88
Score (bit) 30.0
E-value 5.9
Report
BLASTX 2.2.19 [Nov-02-2008]


Reference: Altschul, Stephen F., Thomas L. Madden, Alejandro A. Schaffer,
Jinghui Zhang, Zheng Zhang, Webb Miller, and David J. Lipman (1997),
"Gapped BLAST and PSI-BLAST: a new generation of protein database search
programs", Nucleic Acids Res. 25:3389-3402.

Query= BP918289|Adiantum capillus-veneris mRNA, clone:
YMU001_000111_G02.
(492 letters)

Database: uniprot_sprot.fasta
412,525 sequences; 148,809,765 total letters

Searching..................................................done



Score E
Sequences producing significant alignments: (bits) Value

sp|Q8BGK2|ARHL1_MOUSE [Protein ADP-ribosylarginine] hydrolase-li... 30 5.9
sp|Q23658|CAPS_CAEEL Calcium-dependent secretion activator OS=Ca... 30 7.8
sp|Q5XIB3|ARHL1_RAT [Protein ADP-ribosylarginine] hydrolase-like... 30 7.8

>sp|Q8BGK2|ARHL1_MOUSE [Protein ADP-ribosylarginine] hydrolase-like
protein 1 OS=Mus musculus GN=Adprhl1 PE=2 SV=1
Length = 353

Score = 30.0 bits (66), Expect = 5.9
Identities = 20/88 (22%), Positives = 35/88 (39%), Gaps = 15/88 (17%)
Frame = -2

Query: 293 LFAKLIKSYIELVESVDLHLLSAH*FGSCSLHISGQVMLAYSFPF--------------- 159
L+ +++K Y+E VE++ H CS +LA+ PF
Sbjct: 78 LYREMVKRYVETVETLSEHRPDPSTIEGCSQLKPDNYLLAWHTPFSEKGSGFGAATKAMC 137

Query: 158 ISQQAWQPQ*ENTIKGAHRPCSAMQYNN 75
I + W+P+ T+ C M +N+
Sbjct: 138 IGMRYWKPERLETLIEVSIECGRMTHNH 165


>sp|Q23658|CAPS_CAEEL Calcium-dependent secretion activator
OS=Caenorhabditis elegans GN=unc-31 PE=2 SV=5
Length = 1396

Score = 29.6 bits (65), Expect = 7.8
Identities = 10/27 (37%), Positives = 17/27 (62%)
Frame = +3

Query: 366 VHTLNPVFSSAALYIMKTIPFCCTIKH 446
+HTL+ F S+ + + + FCC +KH
Sbjct: 1 MHTLSSFFMSSYSFFLSAVLFCCFLKH 27


>sp|Q5XIB3|ARHL1_RAT [Protein ADP-ribosylarginine] hydrolase-like
protein 1 OS=Rattus norvegicus GN=Adprhl1 PE=2 SV=1
Length = 353

Score = 29.6 bits (65), Expect = 7.8
Identities = 20/88 (22%), Positives = 34/88 (38%), Gaps = 15/88 (17%)
Frame = -2

Query: 293 LFAKLIKSYIELVESVDLHLLSAH*FGSCSLHISGQVMLAYSFPF--------------- 159
L+ +++K Y+E VE + H CS +LA+ PF
Sbjct: 78 LYREMVKRYVETVEKLSEHRPDPSTIEGCSQLKPDNYLLAWHTPFSEKGSGFGAATKAMC 137

Query: 158 ISQQAWQPQ*ENTIKGAHRPCSAMQYNN 75
I + W+P+ T+ C M +N+
Sbjct: 138 IGMRYWKPERLETLIEVSIECGRMTHNH 165


tr_hit_id -
Definition No hits.
Align length -
Score (bit) -
E-value -
Report
BLASTX 2.2.19 [Nov-02-2008]


Reference: Altschul, Stephen F., Thomas L. Madden, Alejandro A. Schaffer,
Jinghui Zhang, Zheng Zhang, Webb Miller, and David J. Lipman (1997),
"Gapped BLAST and PSI-BLAST: a new generation of protein database search
programs", Nucleic Acids Res. 25:3389-3402.

Query= BP918289|Adiantum capillus-veneris mRNA, clone:
YMU001_000111_G02.
(492 letters)

Database: uniprot_trembl.fasta
7,341,751 sequences; 2,391,615,440 total letters

Searching..................................................done

***** No hits found ******