BP918327
Clone id YMU001_000112_C01
Library
Length 373
Definition Adiantum capillus-veneris mRNA. clone: YMU001_000112_C01.
Accession
Tissue type prothallium
Developmental stage -
Contig ID
Sequence
CAATTGATTGCTTTATTTGTCCGATTTCATTCAGCAAATTGACAACATCCCTTATAACTG
GTCTTTTCAGCGGGATTTCGATTGATACATGAGCATGCTATTTCTAGTAACTGCTGCATC
TGCTCTTGAAAGGGCTTGATTCTCAAACAGCTGTCATATATTTGATCTAATTTATGGTCC
TTCTTCATCTCATGCACCCAAGCTACAAGATCCCCACATCCTCTTGGTTTGCAGACATCA
ACGGGCCTCTTACCCGTCAACAACTCGAGAAGAACCACCCCAAAACTATAGACATCACCT
CTTGTGGTTGCATTCAAAGCCCCACCATACTCAGGAGGTATGTATCCAAAAGTTCCCACC
AACTCTGTTGTCA
■■Homology search results ■■ -
sp_hit_id Q9C7S5
Definition sp|Q9C7S5|PSYR1_ARATH Tyrosine-sulfated glycopeptide receptor 1 OS=Arabidopsis thaliana
Align length 125
Score (bit) 134.0
E-value 2.0e-31
Report
BLASTX 2.2.19 [Nov-02-2008]


Reference: Altschul, Stephen F., Thomas L. Madden, Alejandro A. Schaffer,
Jinghui Zhang, Zheng Zhang, Webb Miller, and David J. Lipman (1997),
"Gapped BLAST and PSI-BLAST: a new generation of protein database search
programs", Nucleic Acids Res. 25:3389-3402.

Query= BP918327|Adiantum capillus-veneris mRNA, clone:
YMU001_000112_C01.
(373 letters)

Database: uniprot_sprot.fasta
412,525 sequences; 148,809,765 total letters

Searching..................................................done



Score E
Sequences producing significant alignments: (bits) Value

sp|Q9C7S5|PSYR1_ARATH Tyrosine-sulfated glycopeptide receptor 1 ... 134 2e-31
sp|Q9ZVR7|PSKR1_ARATH Phytosulfokine receptor 1 OS=Arabidopsis t... 130 3e-30
sp|Q8LPB4|PSKR1_DAUCA Phytosulfokine receptor 1 OS=Daucus carota... 129 3e-30
sp|Q9FN37|PSKR2_ARATH Phytosulfokine receptor 2 OS=Arabidopsis t... 117 2e-26
sp|Q9LYN8|EXS_ARATH Leucine-rich repeat receptor protein kinase ... 88 2e-17
sp|Q9LHP4|RCH2_ARATH Receptor-like protein kinase 2 OS=Arabidops... 81 4e-16
sp|Q3EDL4|Y1154_ARATH Putative serine/threonine-protein kinase A... 79 5e-15
sp|O04567|Y1719_ARATH Probable inactive receptor kinase At1g2719... 76 6e-14
sp|Q8L899|BRI1_SOLPE Systemin receptor SR160 OS=Solanum peruvian... 75 1e-13
sp|Q8GUQ5|BRI1_SOLLC Brassinosteroid LRR receptor kinase OS=Sola... 75 1e-13
sp|O22476|BRI1_ARATH Protein BRASSINOSTEROID INSENSITIVE 1 OS=Ar... 75 1e-13
sp|Q9LJF3|BRL3_ARATH Serine/threonine-protein kinase BRI1-like 3... 74 3e-13
sp|Q9ZWC8|BRL1_ARATH Serine/threonine-protein kinase BRI1-like 1... 74 3e-13
sp|Q9LQQ8|RLCK7_ARATH Probable serine/threonine-protein kinase R... 70 4e-13
sp|Q8RY17|WAKLI_ARATH Wall-associated receptor kinase-like 22 OS... 72 7e-13
sp|P27450|CX32_ARATH Probable serine/threonine-protein kinase Cx... 72 7e-13
sp|Q7X8C5|WAKLB_ARATH Wall-associated receptor kinase-like 2 OS=... 72 9e-13
sp|Q9FE20|PBS1_ARATH Serine/threonine-protein kinase PBS1 OS=Ara... 72 9e-13
sp|Q94F62|BAK1_ARATH BRASSINOSTEROID INSENSITIVE 1-associated re... 71 2e-12
sp|P46573|APK1B_ARATH Protein kinase APK1B, chloroplastic OS=Ara... 70 2e-12
sp|P47735|RLK5_ARATH Receptor-like protein kinase 5 OS=Arabidops... 68 3e-12
sp|Q9S9M3|WAKLC_ARATH Wall-associated receptor kinase-like 3 OS=... 70 4e-12
sp|Q9S9M5|WAKLA_ARATH Wall-associated receptor kinase-like 1 OS=... 69 6e-12
sp|Q06548|APK1A_ARATH Protein kinase APK1A, chloroplastic OS=Ara... 69 6e-12
sp|Q8LKZ1|NORK_PEA Nodulation receptor kinase OS=Pisum sativum G... 69 7e-12
sp|Q9M0X5|CRK25_ARATH Cysteine-rich receptor-like protein kinase... 69 7e-12
sp|Q9FHK7|Y5516_ARATH Probable receptor kinase At5g05160 OS=Arab... 69 9e-12
sp|Q9LZM4|WAKLQ_ARATH Putative wall-associated receptor kinase-l... 69 9e-12
sp|Q9SA25|WAKLG_ARATH Wall-associated receptor kinase-like 8 OS=... 69 9e-12
sp|Q8L4H4|NORK_MEDTR Nodulation receptor kinase OS=Medicago trun... 69 9e-12

>sp|Q9C7S5|PSYR1_ARATH Tyrosine-sulfated glycopeptide receptor 1
OS=Arabidopsis thaliana GN=PSYR1 PE=2 SV=1
Length = 1095

Score = 134 bits (336), Expect = 2e-31
Identities = 66/125 (52%), Positives = 91/125 (72%), Gaps = 5/125 (4%)
Frame = -3

Query: 371 TTELVGTFGYIPPEYGGALNATTRGDVYSFGVVLLELLTGKRPVDVCKPRGCGDLVAWVH 192
TTELVGT GYIPPEYG A AT RGDVYSFGVV+LELLTGKRP++V +P+ +LVAWVH
Sbjct: 962 TTELVGTLGYIPPEYGQAWVATLRGDVYSFGVVMLELLTGKRPMEVFRPKMSRELVAWVH 1021

Query: 191 EMKKDHKLDQIYDSCLRIKPFQEQMQQLLEIACSCINRNPAEKTSYKGCCQF-----AE* 27
MK+D K ++++D+ LR +E M ++L+IAC C+N+NP ++ + + + AE
Sbjct: 1022 TMKRDGKPEEVFDTLLRESGNEEAMLRVLDIACMCVNQNPMKRPNIQQVVDWLKNIEAEK 1081

Query: 26 NRTNK 12
N+ N+
Sbjct: 1082 NQNNR 1086


>sp|Q9ZVR7|PSKR1_ARATH Phytosulfokine receptor 1 OS=Arabidopsis
thaliana GN=PSKR1 PE=2 SV=4
Length = 1008

Score = 130 bits (326), Expect = 3e-30
Identities = 58/103 (56%), Positives = 80/103 (77%)
Frame = -3

Query: 371 TTELVGTFGYIPPEYGGALNATTRGDVYSFGVVLLELLTGKRPVDVCKPRGCGDLVAWVH 192
+T+LVGT GYIPPEYG A AT +GDVYSFGVVLLELLT KRPVD+CKP+GC DL++WV
Sbjct: 893 STDLVGTLGYIPPEYGQASVATYKGDVYSFGVVLLELLTDKRPVDMCKPKGCRDLISWVV 952

Query: 191 EMKKDHKLDQIYDSCLRIKPFQEQMQQLLEIACSCINRNPAEK 63
+MK + + +++D + K ++M ++LEIAC C++ NP ++
Sbjct: 953 KMKHESRASEVFDPLIYSKENDKEMFRVLEIACLCLSENPKQR 995


>sp|Q8LPB4|PSKR1_DAUCA Phytosulfokine receptor 1 OS=Daucus carota
GN=PSKR PE=1 SV=1
Length = 1021

Score = 129 bits (325), Expect = 3e-30
Identities = 61/100 (61%), Positives = 76/100 (76%)
Frame = -3

Query: 371 TTELVGTFGYIPPEYGGALNATTRGDVYSFGVVLLELLTGKRPVDVCKPRGCGDLVAWVH 192
TT+LVGT GYIPPEYG A AT +GDVYSFGVVLLELLTG+RP+DVCKPRG DL++WV
Sbjct: 902 TTDLVGTLGYIPPEYGQASVATYKGDVYSFGVVLLELLTGRRPMDVCKPRGSRDLISWVL 961

Query: 191 EMKKDHKLDQIYDSCLRIKPFQEQMQQLLEIACSCINRNP 72
+MK + + +I+D + K E+M +LEIAC C+ NP
Sbjct: 962 QMKTEKRESEIFDPFIYDKDHAEEMLLVLEIACRCLGENP 1001


>sp|Q9FN37|PSKR2_ARATH Phytosulfokine receptor 2 OS=Arabidopsis
thaliana GN=PSKR2 PE=2 SV=1
Length = 1036

Score = 117 bits (292), Expect = 2e-26
Identities = 55/103 (53%), Positives = 75/103 (72%)
Frame = -3

Query: 371 TTELVGTFGYIPPEYGGALNATTRGDVYSFGVVLLELLTGKRPVDVCKPRGCGDLVAWVH 192
TT+LVGT GYIPPEY +L AT RGDVYSFGVVLLEL+TG+RPV+VCK + C DLV+ V
Sbjct: 913 TTDLVGTLGYIPPEYSQSLIATCRGDVYSFGVVLLELVTGRRPVEVCKGKSCRDLVSRVF 972

Query: 191 EMKKDHKLDQIYDSCLRIKPFQEQMQQLLEIACSCINRNPAEK 63
+MK + + ++ D+ +R + + ++LEIAC CI+ P +
Sbjct: 973 QMKAEKREAELIDTTIRENVNERTVLEMLEIACKCIDHEPRRR 1015


>sp|Q9LYN8|EXS_ARATH Leucine-rich repeat receptor protein kinase EXS
OS=Arabidopsis thaliana GN=EXS PE=1 SV=1
Length = 1192

Score = 87.8 bits (216), Expect = 2e-17
Identities = 47/105 (44%), Positives = 63/105 (60%), Gaps = 2/105 (1%)
Frame = -3

Query: 371 TTELVGTFGYIPPEYGGALNATTRGDVYSFGVVLLELLTGKRPV--DVCKPRGCGDLVAW 198
+T + GTFGYIPPEYG + ATT+GDVYSFGV+LLEL+TGK P D + G G+LV W
Sbjct: 1076 STVIAGTFGYIPPEYGQSARATTKGDVYSFGVILLELVTGKEPTGPDFKESEG-GNLVGW 1134

Query: 197 VHEMKKDHKLDQIYDSCLRIKPFQEQMQQLLEIACSCINRNPAEK 63
+ K + D L + +LL+IA C+ PA++
Sbjct: 1135 AIQKINQGKAVDVIDPLLVSVALKNSQLRLLQIAMLCLAETPAKR 1179


>sp|Q9LHP4|RCH2_ARATH Receptor-like protein kinase 2 OS=Arabidopsis
thaliana GN=RCH2 PE=1 SV=1
Length = 1141

Score = 81.3 bits (199), Expect(2) = 4e-16
Identities = 44/106 (41%), Positives = 66/106 (62%), Gaps = 2/106 (1%)
Frame = -3

Query: 362 LVGTFGYIPPEYGGALNATTRGDVYSFGVVLLELLTGKRPVDVCKPRGCGDLVAWVHEMK 183
+ G++GYI PEYG ++ T + DVYS+GVV+LE+LTGK+P+D P G LV WV + +
Sbjct: 956 VAGSYGYIAPEYGYSMKITEKSDVYSYGVVVLEVLTGKQPIDPTVPEGI-HLVDWVRQNR 1014

Query: 182 KDHKLDQIYDSCLRIKPFQE--QMQQLLEIACSCINRNPAEKTSYK 51
++ DS LR + E +M Q+L A C+N +P E+ + K
Sbjct: 1015 GSL---EVLDSTLRSRTEAEADEMMQVLGTALLCVNSSPDERPTMK 1057



Score = 22.3 bits (46), Expect(2) = 4e-16
Identities = 9/22 (40%), Positives = 15/22 (68%)
Frame = -1

Query: 73 PLKRPVIRDVVNLLNEIGQIKQ 8
P +RP ++DV +L EI Q ++
Sbjct: 1050 PDERPTMKDVAAMLKEIKQERE 1071


>sp|Q3EDL4|Y1154_ARATH Putative serine/threonine-protein kinase
At1g01540 OS=Arabidopsis thaliana GN=At1g01540 PE=1 SV=2
Length = 472

Score = 79.3 bits (194), Expect = 5e-15
Identities = 32/97 (32%), Positives = 62/97 (63%)
Frame = -3

Query: 371 TTELVGTFGYIPPEYGGALNATTRGDVYSFGVVLLELLTGKRPVDVCKPRGCGDLVAWVH 192
TT ++GTFGY+ PEY + D+YSFG++++E++TG+ PVD +P+G +LV W+
Sbjct: 313 TTRVMGTFGYVAPEYACTGMLNEKSDIYSFGILIMEIITGRNPVDYSRPQGETNLVDWLK 372

Query: 191 EMKKDHKLDQIYDSCLRIKPFQEQMQQLLEIACSCIN 81
M + + +++ D + P + ++++L +A C++
Sbjct: 373 SMVGNRRSEEVVDPKIPEPPSSKALKRVLLVALRCVD 409


>sp|O04567|Y1719_ARATH Probable inactive receptor kinase At1g27190
OS=Arabidopsis thaliana GN=At1g27190 PE=1 SV=1
Length = 601

Score = 75.9 bits (185), Expect = 6e-14
Identities = 39/101 (38%), Positives = 57/101 (56%), Gaps = 2/101 (1%)
Frame = -3

Query: 359 VGTFGYIPPEYGGALNATTRGDVYSFGVVLLELLTGKRPVDVCK--PRGCGDLVAWVHEM 186
+G GY+ PEY + A+ +GDVY FG+VLLEL+TG++P+ V G LV WV +
Sbjct: 466 LGELGYVAPEYSSTMVASLKGDVYGFGIVLLELVTGQKPLSVINGVEGFKGSLVDWVSQY 525

Query: 185 KKDHKLDQIYDSCLRIKPFQEQMQQLLEIACSCINRNPAEK 63
+ D + K E++ Q L+IACSC+ P E+
Sbjct: 526 LGTGRSKDAIDRSICDKGHDEEILQFLKIACSCVVSRPKER 566


>sp|Q8L899|BRI1_SOLPE Systemin receptor SR160 OS=Solanum peruvianum
PE=1 SV=1
Length = 1207

Score = 75.1 bits (183), Expect = 1e-13
Identities = 41/96 (42%), Positives = 61/96 (63%), Gaps = 2/96 (2%)
Frame = -3

Query: 362 LVGTFGYIPPEYGGALNATTRGDVYSFGVVLLELLTGKRPVDVCKPRGCGDLVAWVHEMK 183
L GT GY+PPEY + +T+GDVYS+GVVLLELLTGK+P D G +LV WV ++
Sbjct: 1051 LAGTPGYVPPEYYQSFRCSTKGDVYSYGVVLLELLTGKQPTD-SADFGDNNLVGWV-KLH 1108

Query: 182 KDHKLDQIYDSCL--RIKPFQEQMQQLLEIACSCIN 81
K+ ++D L + ++ Q L++AC+C++
Sbjct: 1109 AKGKITDVFDRELLKEDASIEIELLQHLKVACACLD 1144


>sp|Q8GUQ5|BRI1_SOLLC Brassinosteroid LRR receptor kinase OS=Solanum
lycopersicum GN=CURL3 PE=1 SV=1
Length = 1207

Score = 75.1 bits (183), Expect = 1e-13
Identities = 41/96 (42%), Positives = 61/96 (63%), Gaps = 2/96 (2%)
Frame = -3

Query: 362 LVGTFGYIPPEYGGALNATTRGDVYSFGVVLLELLTGKRPVDVCKPRGCGDLVAWVHEMK 183
L GT GY+PPEY + +T+GDVYS+GVVLLELLTGK+P D G +LV WV ++
Sbjct: 1051 LAGTPGYVPPEYYQSFRCSTKGDVYSYGVVLLELLTGKQPTD-SADFGDNNLVGWV-KLH 1108

Query: 182 KDHKLDQIYDSCL--RIKPFQEQMQQLLEIACSCIN 81
K+ ++D L + ++ Q L++AC+C++
Sbjct: 1109 AKGKITDVFDRELLKEDASIEIELLQHLKVACACLD 1144


tr_hit_id A7P692
Definition tr|A7P692|A7P692_VITVI Chromosome chr9 scaffold_7, whole genome shotgun sequence OS=Vitis vinifera
Align length 114
Score (bit) 138.0
E-value 2.0e-31
Report
BLASTX 2.2.19 [Nov-02-2008]


Reference: Altschul, Stephen F., Thomas L. Madden, Alejandro A. Schaffer,
Jinghui Zhang, Zheng Zhang, Webb Miller, and David J. Lipman (1997),
"Gapped BLAST and PSI-BLAST: a new generation of protein database search
programs", Nucleic Acids Res. 25:3389-3402.

Query= BP918327|Adiantum capillus-veneris mRNA, clone:
YMU001_000112_C01.
(373 letters)

Database: uniprot_trembl.fasta
7,341,751 sequences; 2,391,615,440 total letters

Searching..................................................done



Score E
Sequences producing significant alignments: (bits) Value

tr|A7P692|A7P692_VITVI Chromosome chr9 scaffold_7, whole genome ... 138 2e-31
tr|A5BTZ5|A5BTZ5_VITVI Putative uncharacterized protein OS=Vitis... 138 2e-31
tr|B8XA57|B8XA57_GOSBA Receptor kinase OS=Gossypium barbadense P... 129 6e-30
tr|A7PNI2|A7PNI2_VITVI Chromosome chr1 scaffold_22, whole genome... 130 4e-29
tr|A7P1Q9|A7P1Q9_VITVI Chromosome chr19 scaffold_4, whole genome... 129 7e-29
tr|A5AEK7|A5AEK7_VITVI Putative uncharacterized protein OS=Vitis... 129 7e-29
tr|Q6K213|Q6K213_ORYSJ Putative phytosulfokine receptor OS=Oryza... 123 4e-27
tr|Q0DZD2|Q0DZD2_ORYSJ Os02g0629400 protein OS=Oryza sativa subs... 123 4e-27
tr|B8AFR3|B8AFR3_ORYSI Putative uncharacterized protein OS=Oryza... 123 4e-27
tr|Q8H3W8|Q8H3W8_ORYSJ Putative phytosulfokine receptor OS=Oryza... 120 3e-26
tr|Q0D948|Q0D948_ORYSJ Os07g0107800 protein OS=Oryza sativa subs... 120 3e-26
tr|B8B6K3|B8B6K3_ORYSI Putative uncharacterized protein OS=Oryza... 120 3e-26
tr|A3BFU4|A3BFU4_ORYSJ Putative uncharacterized protein OS=Oryza... 120 3e-26
tr|Q258Z9|Q258Z9_ORYSA H0322F07.1 protein OS=Oryza sativa GN=H03... 119 7e-26
tr|A2XYU4|A2XYU4_ORYSI Putative uncharacterized protein OS=Oryza... 119 7e-26
tr|Q7XPI1|Q7XPI1_ORYSA OSJNBb0004A17.8 protein OS=Oryza sativa G... 118 2e-25
tr|Q0J950|Q0J950_ORYSJ Os04g0672100 protein OS=Oryza sativa subs... 118 2e-25
tr|A3AYI5|A3AYI5_ORYSJ Putative uncharacterized protein OS=Oryza... 118 2e-25
tr|Q67IT5|Q67IT5_ORYSJ Os02g0153700 protein OS=Oryza sativa subs... 112 4e-25
tr|Q5UD38|Q5UD38_ORYRU Putative leucine-rich repeat receptor-lik... 112 4e-25
tr|Q66QA6|Q66QA6_ORYSI Putative leucine-rich repeat receptor-lik... 110 1e-24
tr|B8AHU8|B8AHU8_ORYSI Putative uncharacterized protein OS=Oryza... 110 1e-24
tr|B4FRW9|B4FRW9_MAIZE Putative uncharacterized protein OS=Zea m... 115 1e-24
tr|Q67IT8|Q67IT8_ORYSJ Putative Phytosulfokine receptor (Putativ... 114 2e-24
tr|Q66QA3|Q66QA3_ORYSI Putative leucine-rich repeat receptor-lik... 114 2e-24
tr|Q5UD35|Q5UD35_ORYRU Putative leucine-rich repeat receptor-lik... 114 2e-24
tr|Q0E3U9|Q0E3U9_ORYSJ Os02g0153200 protein OS=Oryza sativa subs... 114 2e-24
tr|B8AHU7|B8AHU7_ORYSI Putative uncharacterized protein OS=Oryza... 114 2e-24
tr|B8AHT9|B8AHT9_ORYSI Putative uncharacterized protein OS=Oryza... 114 2e-24
tr|Q66QA8|Q66QA8_ORYSI Putative uncharacterized protein OS=Oryza... 114 3e-24

>tr|A7P692|A7P692_VITVI Chromosome chr9 scaffold_7, whole genome
shotgun sequence OS=Vitis vinifera GN=GSVIVT00033978001
PE=4 SV=1
Length = 1078

Score = 138 bits (347), Expect = 2e-31
Identities = 65/114 (57%), Positives = 86/114 (75%)
Frame = -3

Query: 371 TTELVGTFGYIPPEYGGALNATTRGDVYSFGVVLLELLTGKRPVDVCKPRGCGDLVAWVH 192
TTELVGT GYIPPEYG A AT RGDVYSFGVV+LELLTGKRPV+V KP+ +LV WV
Sbjct: 955 TTELVGTLGYIPPEYGQAWVATLRGDVYSFGVVMLELLTGKRPVEVFKPKMSRELVGWVQ 1014

Query: 191 EMKKDHKLDQIYDSCLRIKPFQEQMQQLLEIACSCINRNPAEKTSYKGCCQFAE 30
+M+ + K DQ++D LR K F+E+M Q+L++AC C+++NP ++ + K + E
Sbjct: 1015 QMRSEGKQDQVFDPLLRGKGFEEEMLQVLDVACMCVSQNPFKRPTIKEVVNWLE 1068


>tr|A5BTZ5|A5BTZ5_VITVI Putative uncharacterized protein OS=Vitis
vinifera GN=VITISV_009907 PE=4 SV=1
Length = 1188

Score = 138 bits (347), Expect = 2e-31
Identities = 65/114 (57%), Positives = 86/114 (75%)
Frame = -3

Query: 371 TTELVGTFGYIPPEYGGALNATTRGDVYSFGVVLLELLTGKRPVDVCKPRGCGDLVAWVH 192
TTELVGT GYIPPEYG A AT RGDVYSFGVV+LELLTGKRPV+V KP+ +LV WV
Sbjct: 931 TTELVGTLGYIPPEYGQAWVATLRGDVYSFGVVMLELLTGKRPVEVFKPKMSRELVGWVQ 990

Query: 191 EMKKDHKLDQIYDSCLRIKPFQEQMQQLLEIACSCINRNPAEKTSYKGCCQFAE 30
+M+ + K DQ++D LR K F+E+M Q+L++AC C+++NP ++ + K + E
Sbjct: 991 QMRSEGKQDQVFDPLLRGKGFEEEMLQVLDVACMCVSQNPFKRPTIKEVVNWLE 1044


>tr|B8XA57|B8XA57_GOSBA Receptor kinase OS=Gossypium barbadense PE=2
SV=1
Length = 1085

Score = 129 bits (323), Expect(2) = 6e-30
Identities = 59/103 (57%), Positives = 80/103 (77%)
Frame = -3

Query: 371 TTELVGTFGYIPPEYGGALNATTRGDVYSFGVVLLELLTGKRPVDVCKPRGCGDLVAWVH 192
TTELVGT GYIPPEYG A AT RGDVYSFGVV+LELLTGKRPVD+ +P+ +LV+WV
Sbjct: 959 TTELVGTLGYIPPEYGQAWVATLRGDVYSFGVVMLELLTGKRPVDMSRPKTSRELVSWVQ 1018

Query: 191 EMKKDHKLDQIYDSCLRIKPFQEQMQQLLEIACSCINRNPAEK 63
++ + K D+++D L+ K E+M ++L++AC CIN+NP ++
Sbjct: 1019 RLRSEGKQDEVFDPLLKGKGSDEEMLRVLDVACLCINQNPFKR 1061



Score = 25.0 bits (53), Expect(2) = 6e-30
Identities = 10/23 (43%), Positives = 15/23 (65%)
Frame = -1

Query: 73 PLKRPVIRDVVNLLNEIGQIKQS 5
P KRP I++VV L +G I ++
Sbjct: 1058 PFKRPTIQEVVEWLKGVGTINRN 1080


>tr|A7PNI2|A7PNI2_VITVI Chromosome chr1 scaffold_22, whole genome
shotgun sequence OS=Vitis vinifera GN=GSVIVT00021268001
PE=4 SV=1
Length = 1020

Score = 130 bits (326), Expect = 4e-29
Identities = 59/105 (56%), Positives = 81/105 (77%)
Frame = -3

Query: 371 TTELVGTFGYIPPEYGGALNATTRGDVYSFGVVLLELLTGKRPVDVCKPRGCGDLVAWVH 192
TT+LVGT GYIPPEYG A AT +GDVYSFGVVLLELLTGKRP+D+CKPRGC DL++WV
Sbjct: 903 TTDLVGTLGYIPPEYGQASVATYKGDVYSFGVVLLELLTGKRPMDMCKPRGCRDLISWVI 962

Query: 191 EMKKDHKLDQIYDSCLRIKPFQEQMQQLLEIACSCINRNPAEKTS 57
+MKK+ + +++D + K +++ ++L+IAC C++ P + S
Sbjct: 963 QMKKEKRESEVFDPFIYDKQHDKELLRVLDIACLCLSECPKIRPS 1007


>tr|A7P1Q9|A7P1Q9_VITVI Chromosome chr19 scaffold_4, whole genome
shotgun sequence OS=Vitis vinifera GN=GSVIVT00027719001
PE=4 SV=1
Length = 1015

Score = 129 bits (324), Expect = 7e-29
Identities = 61/105 (58%), Positives = 80/105 (76%)
Frame = -3

Query: 371 TTELVGTFGYIPPEYGGALNATTRGDVYSFGVVLLELLTGKRPVDVCKPRGCGDLVAWVH 192
TT+LVGT GYIPPEY L AT +GDVYSFGVVLLELLTG+RPV+VCK + C DLV+WV
Sbjct: 895 TTDLVGTLGYIPPEYSQTLTATFKGDVYSFGVVLLELLTGRRPVEVCKGKNCRDLVSWVF 954

Query: 191 EMKKDHKLDQIYDSCLRIKPFQEQMQQLLEIACSCINRNPAEKTS 57
+MK + K +QI DS + K ++Q ++L IAC CI+++P ++ S
Sbjct: 955 QMKSEKKEEQIMDSSVWDKDREKQFLEVLGIACRCIDQDPRQRPS 999


>tr|A5AEK7|A5AEK7_VITVI Putative uncharacterized protein OS=Vitis
vinifera GN=VITISV_006966 PE=4 SV=1
Length = 1021

Score = 129 bits (324), Expect = 7e-29
Identities = 61/105 (58%), Positives = 80/105 (76%)
Frame = -3

Query: 371 TTELVGTFGYIPPEYGGALNATTRGDVYSFGVVLLELLTGKRPVDVCKPRGCGDLVAWVH 192
TT+LVGT GYIPPEY L AT +GDVYSFGVVLLELLTG+RPV+VCK + C DLV+WV
Sbjct: 901 TTDLVGTLGYIPPEYSQTLTATFKGDVYSFGVVLLELLTGRRPVEVCKGKNCRDLVSWVF 960

Query: 191 EMKKDHKLDQIYDSCLRIKPFQEQMQQLLEIACSCINRNPAEKTS 57
+MK + K +QI DS + K ++Q ++L IAC CI+++P ++ S
Sbjct: 961 QMKSEKKEEQIMDSSVWDKDREKQFLEVLGIACRCIDQDPRQRPS 1005


>tr|Q6K213|Q6K213_ORYSJ Putative phytosulfokine receptor OS=Oryza
sativa subsp. japonica GN=B1469H02.26 PE=4 SV=1
Length = 1047

Score = 123 bits (309), Expect = 4e-27
Identities = 57/100 (57%), Positives = 76/100 (76%)
Frame = -3

Query: 371 TTELVGTFGYIPPEYGGALNATTRGDVYSFGVVLLELLTGKRPVDVCKPRGCGDLVAWVH 192
TT+LVGT GYIPPEYG + A +GDVYSFG+VLLELLTGKRPVD+CKP+G +LV+WV
Sbjct: 924 TTDLVGTLGYIPPEYGQSSVANFKGDVYSFGIVLLELLTGKRPVDMCKPKGARELVSWVL 983

Query: 191 EMKKDHKLDQIYDSCLRIKPFQEQMQQLLEIACSCINRNP 72
MK+ + ++ D + K F+ QM Q+++IAC CI+ +P
Sbjct: 984 HMKEKNCEAEVLDRAMYDKKFEMQMVQMIDIACLCISESP 1023


>tr|Q0DZD2|Q0DZD2_ORYSJ Os02g0629400 protein OS=Oryza sativa subsp.
japonica GN=Os02g0629400 PE=2 SV=1
Length = 1052

Score = 123 bits (309), Expect = 4e-27
Identities = 57/100 (57%), Positives = 76/100 (76%)
Frame = -3

Query: 371 TTELVGTFGYIPPEYGGALNATTRGDVYSFGVVLLELLTGKRPVDVCKPRGCGDLVAWVH 192
TT+LVGT GYIPPEYG + A +GDVYSFG+VLLELLTGKRPVD+CKP+G +LV+WV
Sbjct: 929 TTDLVGTLGYIPPEYGQSSVANFKGDVYSFGIVLLELLTGKRPVDMCKPKGARELVSWVL 988

Query: 191 EMKKDHKLDQIYDSCLRIKPFQEQMQQLLEIACSCINRNP 72
MK+ + ++ D + K F+ QM Q+++IAC CI+ +P
Sbjct: 989 HMKEKNCEAEVLDRAMYDKKFEMQMVQMIDIACLCISESP 1028


>tr|B8AFR3|B8AFR3_ORYSI Putative uncharacterized protein OS=Oryza
sativa subsp. indica GN=OsI_08160 PE=4 SV=1
Length = 1047

Score = 123 bits (309), Expect = 4e-27
Identities = 57/100 (57%), Positives = 76/100 (76%)
Frame = -3

Query: 371 TTELVGTFGYIPPEYGGALNATTRGDVYSFGVVLLELLTGKRPVDVCKPRGCGDLVAWVH 192
TT+LVGT GYIPPEYG + A +GDVYSFG+VLLELLTGKRPVD+CKP+G +LV+WV
Sbjct: 924 TTDLVGTLGYIPPEYGQSSVANFKGDVYSFGIVLLELLTGKRPVDMCKPKGARELVSWVL 983

Query: 191 EMKKDHKLDQIYDSCLRIKPFQEQMQQLLEIACSCINRNP 72
MK+ + ++ D + K F+ QM Q+++IAC CI+ +P
Sbjct: 984 HMKEKNCEAEVLDRAMYDKKFEMQMVQMIDIACLCISESP 1023


>tr|Q8H3W8|Q8H3W8_ORYSJ Putative phytosulfokine receptor OS=Oryza
sativa subsp. japonica GN=P0585H11.109 PE=4 SV=1
Length = 1010

Score = 120 bits (301), Expect = 3e-26
Identities = 57/105 (54%), Positives = 80/105 (76%)
Frame = -3

Query: 371 TTELVGTFGYIPPEYGGALNATTRGDVYSFGVVLLELLTGKRPVDVCKPRGCGDLVAWVH 192
TT+LVGT GYIPPEY ++ AT +GDVYSFGVVLLELLTG+RP+DV K +G DLV++V
Sbjct: 895 TTDLVGTLGYIPPEYSQSVIATPKGDVYSFGVVLLELLTGRRPMDVSKAKGSRDLVSYVL 954

Query: 191 EMKKDHKLDQIYDSCLRIKPFQEQMQQLLEIACSCINRNPAEKTS 57
+MK + K +QI+D+ + K ++Q+ +LE AC CI+ +P ++ S
Sbjct: 955 QMKSEKKEEQIFDTLIWSKTHEKQLFSVLEAACRCISTDPRQRPS 999