BP918329
Clone id YMU001_000112_C03
Library
Length 493
Definition Adiantum capillus-veneris mRNA. clone: YMU001_000112_C03.
Accession
Tissue type prothallium
Developmental stage -
Contig ID
Sequence
TCGGCGCATACTGGTATCCCTTCTTAGCTGGAATTCTCTTCTCATGAGCTTCCTTCTGTT
ATGCAGATCTAAGACATGGTGGCTTGCTCTTCTCCTACCCCTTGGCCCACCAACCTTCTC
CCTCTTTATTCTGGTCAGAGTCTCCACACCATAACCATCTCTCCTCCTCCTCTCTGAGAT
GCCCTCAAATTCACTTACCCAGCCAGAAGACTGTCGGGAAGTTCGCCGTGCAACAAGCCT
GCGTTCATTCACCAATCGGTTTGCATCCTGTCGAAGTCGAGAAATTCTTCCATCTATGGA
TTCATCAGCAGAGTTCTCTCGCTGGCGCTGACGTGAGAGATGAAACTTCTGCTGTCGGCC
ACTAAGAGAAGAACCATGTACACCATCAATCCACTTCCTGGATCGCCAATCCCAGCCAAC
CTGTGCACCATACTGGTCCCTGTGCTGACCTTCGCGATCACGGGTTCTGCGAAGAGCCAG
CTGCTCTTCATCT
■■Homology search results ■■ -
sp_hit_id P0C230
Definition sp|P0C230|PRT_OSITU Protamine OS=Osilinus turbinatus
Align length 94
Score (bit) 38.9
E-value 0.013
Report
BLASTX 2.2.19 [Nov-02-2008]


Reference: Altschul, Stephen F., Thomas L. Madden, Alejandro A. Schaffer,
Jinghui Zhang, Zheng Zhang, Webb Miller, and David J. Lipman (1997),
"Gapped BLAST and PSI-BLAST: a new generation of protein database search
programs", Nucleic Acids Res. 25:3389-3402.

Query= BP918329|Adiantum capillus-veneris mRNA, clone:
YMU001_000112_C03.
(493 letters)

Database: uniprot_sprot.fasta
412,525 sequences; 148,809,765 total letters

Searching..................................................done



Score E
Sequences producing significant alignments: (bits) Value

sp|P0C230|PRT_OSITU Protamine OS=Osilinus turbinatus PE=1 SV=1 39 0.013
sp|Q1B849|PAPA5_MYCSS Phthiocerol/phthiodiolone dimycocerosyl tr... 37 0.038
sp|A1UGV8|PAPA5_MYCSK Phthiocerol/phthiodiolone dimycocerosyl tr... 37 0.038
sp|A3Q0G0|PAPA5_MYCSJ Phthiocerol/phthiodiolone dimycocerosyl tr... 37 0.038
sp|P36783|VE2_HPV14 Regulatory protein E2 OS=Human papillomaviru... 36 0.084
sp|Q07283|TRHY_HUMAN Trichohyalin OS=Homo sapiens GN=TCHH PE=1 SV=2 36 0.084
sp|Q9CS00|CS029_MOUSE Uncharacterized protein C19orf29 homolog O... 36 0.084
sp|Q5U4C3|SFR19_MOUSE Splicing factor, arginine/serine-rich 19 O... 36 0.11
sp|Q9WTV7|RNF12_MOUSE E3 ubiquitin-protein ligase RNF12 OS=Mus m... 35 0.14
sp|Q8H0U8|RH42_ARATH DEAD-box ATP-dependent RNA helicase 42 OS=A... 35 0.19
sp|O43280|TREA_HUMAN Trehalase OS=Homo sapiens GN=TREH PE=1 SV=2 34 0.32
sp|Q0D1K3|PRP5_ASPTN Pre-mRNA-processing ATP-dependent RNA helic... 34 0.32
sp|Q27450|CYP1_BRUMA Peptidyl-prolyl cis-trans isomerase 1 OS=Br... 33 0.71
sp|Q6ZQQ6|WDR87_HUMAN WD repeat-containing protein 87 OS=Homo sa... 32 2.1
sp|P22793|TRHY_SHEEP Trichohyalin OS=Ovis aries GN=TCHH PE=2 SV=2 32 2.1
sp|Q80YR5|SAFB2_MOUSE Scaffold attachment factor B2 OS=Mus muscu... 32 2.1
sp|P52016|CYP8_CAEEL Peptidyl-prolyl cis-trans isomerase 8 OS=Ca... 32 2.1
sp|Q4WT99|PRP5_ASPFU Pre-mRNA-processing ATP-dependent RNA helic... 31 2.7
sp|Q8TB45|DEPD6_HUMAN DEP domain-containing protein 6 OS=Homo sa... 31 2.7
sp|Q0C187|RRMJ_HYPNA Ribosomal RNA large subunit methyltransfera... 31 3.5
sp|Q10447|PPK2_SCHPO Protein kinase domain-containing protein pp... 31 3.5
sp|A6NEF3|GG6L4_HUMAN Putative golgin subfamily A member 6-like ... 31 3.5
sp|Q570Y9|DEPD6_MOUSE DEP domain-containing protein 6 OS=Mus mus... 31 3.5
sp|Q93WU4|SPP3A_ARATH Probable sucrose-phosphatase 3a OS=Arabido... 30 4.5
sp|P07856|SERI1_BOMMO Sericin 1 OS=Bombyx mori GN=ser1 PE=1 SV=2 30 4.6
sp|Q8WUQ7|CS029_HUMAN Uncharacterized protein C19orf29 OS=Homo s... 30 4.6
sp|Q04893|YM96_YEAST Uncharacterized protein YMR317W OS=Saccharo... 30 6.0
sp|A1D373|PRP5_NEOFI Pre-mRNA-processing ATP-dependent RNA helic... 30 6.0
sp|Q6P5L7|ARGLA_DANRE Arginine and glutamate-rich protein 1-A OS... 30 6.0
sp|Q4P4G8|U396_USTMA UPF0396 protein UM04995 OS=Ustilago maydis ... 30 7.9

>sp|P0C230|PRT_OSITU Protamine OS=Osilinus turbinatus PE=1 SV=1
Length = 106

Score = 38.9 bits (89), Expect = 0.013
Identities = 32/94 (34%), Positives = 46/94 (48%)
Frame = -2

Query: 282 SRLRQDANRLVNERRLVARRTSRQSSGWVSEFEGISERRRRDGYGVETLTRIKREKVGGP 103
SR R+ +R + +R +RR SR S+G S RRRR +++R +R +
Sbjct: 13 SRSRKSRSRSRSAKRSASRRRSR-SAGRRRRRRTASRRRRRSASRRRSVSRRRRRRSRKS 71

Query: 102 RGRRRASHHVLDLHNRRKLMRREFQLRRDTSMRR 1
RGRRR V RR++ R + RR T RR
Sbjct: 72 RGRRRRGRKV----RRRRVKRAGRKGRRRTRRRR 101


>sp|Q1B849|PAPA5_MYCSS Phthiocerol/phthiodiolone dimycocerosyl
transferase OS=Mycobacterium sp. (strain MCS) GN=papA5
PE=3 SV=2
Length = 410

Score = 37.4 bits (85), Expect = 0.038
Identities = 29/99 (29%), Positives = 47/99 (47%), Gaps = 11/99 (11%)
Frame = +1

Query: 190 FTYPARRLSGSSPCNKPAFIHQSVCILSKSRNSSI--YGFISRVLSLALT*EMKLLLSAT 363
+ P +R++ S +PA + + C LSK+ SS+ YG ++R+ L LL
Sbjct: 185 YELPPKRVTTRSAAERPAAVPTTRCRLSKAETSSLVKYGRVNRLFVNNLISAAILLAEWQ 244

Query: 364 KRRT-------MYTIN--PLPGSPIPANLCTILVPVLTF 453
RRT +Y +N L P+ A CT+ + V T+
Sbjct: 245 VRRTPHIPIPYVYNVNLRALVEPPVSATGCTLAIGVATY 283


>sp|A1UGV8|PAPA5_MYCSK Phthiocerol/phthiodiolone dimycocerosyl
transferase OS=Mycobacterium sp. (strain KMS) GN=papA5
PE=3 SV=1
Length = 410

Score = 37.4 bits (85), Expect = 0.038
Identities = 29/99 (29%), Positives = 47/99 (47%), Gaps = 11/99 (11%)
Frame = +1

Query: 190 FTYPARRLSGSSPCNKPAFIHQSVCILSKSRNSSI--YGFISRVLSLALT*EMKLLLSAT 363
+ P +R++ S +PA + + C LSK+ SS+ YG ++R+ L LL
Sbjct: 185 YELPPKRVTTRSAAERPAAVPTTRCRLSKAETSSLVKYGRVNRLFVNNLISAAILLAEWQ 244

Query: 364 KRRT-------MYTIN--PLPGSPIPANLCTILVPVLTF 453
RRT +Y +N L P+ A CT+ + V T+
Sbjct: 245 VRRTPHIPIPYVYNVNLRALVEPPVSATGCTLAIGVATY 283


>sp|A3Q0G0|PAPA5_MYCSJ Phthiocerol/phthiodiolone dimycocerosyl
transferase OS=Mycobacterium sp. (strain JLS) GN=papA5
PE=3 SV=1
Length = 410

Score = 37.4 bits (85), Expect = 0.038
Identities = 29/99 (29%), Positives = 47/99 (47%), Gaps = 11/99 (11%)
Frame = +1

Query: 190 FTYPARRLSGSSPCNKPAFIHQSVCILSKSRNSSI--YGFISRVLSLALT*EMKLLLSAT 363
+ P +R++ S +PA + + C LSK+ SS+ YG ++R+ L LL
Sbjct: 185 YELPPKRVTTRSAAERPAAVPTTRCRLSKAETSSLVKYGRVNRLFVNNLISAAILLAEWQ 244

Query: 364 KRRT-------MYTIN--PLPGSPIPANLCTILVPVLTF 453
RRT +Y +N L P+ A CT+ + V T+
Sbjct: 245 VRRTPHIPIPYVYNVNLRALVEPPVSATGCTLAIGVATY 283


>sp|P36783|VE2_HPV14 Regulatory protein E2 OS=Human papillomavirus
type 14 GN=E2 PE=3 SV=1
Length = 483

Score = 36.2 bits (82), Expect = 0.084
Identities = 31/101 (30%), Positives = 42/101 (41%), Gaps = 2/101 (1%)
Frame = -2

Query: 378 HGSSLSGRQQKFHLSRQRQRENSADESIDGRISRLRQDANRLVNERRLVARRTSRQSSGW 199
+G S R ++ +RQR+R S S SRLR + +ERR R SR
Sbjct: 249 YGRRPSSRTRRTTETRQRRRSRSKSRSRSRSRSRLRSRSRSQSSERRSRYRSRSRSRQKE 308

Query: 198 VSEFEGISERRRRDGYGVET--LTRIKREKVGGPRGRRRAS 82
VS + R R + R + GG RGRR +S
Sbjct: 309 VSRITTTTRGRGRGSSSTSSKRSQRARGRGRGGSRGRRSSS 349


>sp|Q07283|TRHY_HUMAN Trichohyalin OS=Homo sapiens GN=TCHH PE=1 SV=2
Length = 1943

Score = 36.2 bits (82), Expect = 0.084
Identities = 40/169 (23%), Positives = 64/169 (37%), Gaps = 5/169 (2%)
Frame = -2

Query: 492 DEEQLALRRTRDR-----EGQHRDQYGAQVGWDWRSRKWIDGVHGSSLSGRQQKFHLSRQ 328
+EEQ R+ R+R E Q R Q Q R RK+ + S R +KF Q
Sbjct: 1378 EEEQRLRRQERERKFLKEEQQLRCQEREQQLRQDRDRKFREEEQQLSRQERDRKFREEEQ 1437

Query: 327 RQRENSADESIDGRISRLRQDANRLVNERRLVARRTSRQSSGWVSEFEGISERRRRDGYG 148
+ R + +LRQ+ +R E + + Q R+ RD
Sbjct: 1438 QVRRQERERKFLEEEQQLRQERHRKFREEEQLLQEREEQQ----------LHRQERDRKF 1487

Query: 147 VETLTRIKREKVGGPRGRRRASHHVLDLHNRRKLMRREFQLRRDTSMRR 1
+E +++R++ R R+ + RK + E QL R R+
Sbjct: 1488 LEEEQQLRRQE----RDRKFREQELRSQEPERKFLEEEQQLHRQQRQRK 1532



Score = 32.0 bits (71), Expect = 1.6
Identities = 44/180 (24%), Positives = 71/180 (39%), Gaps = 16/180 (8%)
Frame = -2

Query: 492 DEEQLALRRTRDREGQHRDQYGAQVGWDWRSRKWIDGVHGSSLSGRQ------------Q 349
+E+Q R +DR Q ++ +WR R+ + L + Q
Sbjct: 224 EEKQQQRRERQDRVFQEEEEK------EWRKRETVLRKEEEKLQEEEPQRQRELQEEEEQ 277

Query: 348 KFHLSRQR-QRENSADESIDGRISRLRQDANRLVNERR--LVARRTSRQSSGWVSEFEGI 178
L RQ +RE +E R+ R +Q + ERR RR ++ E
Sbjct: 278 LRKLERQELRRERQEEEQQQQRLRREQQLRRKQEEERREQQEERREQQERREQQEERREQ 337

Query: 177 SERRRRDGYGVETLTRIKREKVGGPRGRRRASHHVLDLHNRRKL-MRREFQLRRDTSMRR 1
RR ++ + L R + E+ + RR + RR+ +RRE QLRR+ +RR
Sbjct: 338 QLRREQEERREQQLRREQEEERREQQLRREQEEERREQQLRREQQLRREQQLRREQQLRR 397



Score = 31.6 bits (70), Expect = 2.1
Identities = 31/119 (26%), Positives = 48/119 (40%), Gaps = 1/119 (0%)
Frame = -2

Query: 354 QQKFHLSRQRQ-RENSADESIDGRISRLRQDANRLVNERRLVARRTSRQSSGWVSEFEGI 178
QQ+ L R++Q R +E + + R Q R E R + Q +
Sbjct: 295 QQQQRLRREQQLRRKQEEERREQQEERREQQERREQQEERREQQLRREQEERREQQLRRE 354

Query: 177 SERRRRDGYGVETLTRIKREKVGGPRGRRRASHHVLDLHNRRKLMRREFQLRRDTSMRR 1
E RR+ + L R + E+ + RR R + +RRE QLRR+ +RR
Sbjct: 355 QEEERRE----QQLRREQEEERREQQLRREQQLRREQQLRREQQLRREQQLRREQQLRR 409



Score = 30.0 bits (66), Expect = 6.0
Identities = 28/119 (23%), Positives = 52/119 (43%)
Frame = -2

Query: 357 RQQKFHLSRQRQRENSADESIDGRISRLRQDANRLVNERRLVARRTSRQSSGWVSEFEGI 178
R+Q+ ++ +R +E + + R +Q+ R RR R +Q E E
Sbjct: 302 REQQLRRKQEEERREQQEERREQQERREQQEERREQQLRREQEERREQQLRREQEE-ERR 360

Query: 177 SERRRRDGYGVETLTRIKREKVGGPRGRRRASHHVLDLHNRRKLMRREFQLRRDTSMRR 1
++ RR+ +++RE+ + R + R + +RRE QLRR+ +RR
Sbjct: 361 EQQLRREQEEERREQQLRREQQLRREQQLRREQQL----RREQQLRREQQLRREQQLRR 415


>sp|Q9CS00|CS029_MOUSE Uncharacterized protein C19orf29 homolog
OS=Mus musculus PE=1 SV=2
Length = 772

Score = 36.2 bits (82), Expect = 0.084
Identities = 30/90 (33%), Positives = 37/90 (41%)
Frame = -2

Query: 429 GAQVGWDWRSRKWIDGVHGSSLSGRQQKFHLSRQRQRENSADESIDGRISRLRQDANRLV 250
G Q+G D RSR G G R + SR R R S S S R R
Sbjct: 5 GRQMGRDSRSRSRSVGRRGRKQRSRSRGRSRSRSRSRSRSRSRSRSRSRSHGRSSRRRRE 64

Query: 249 NERRLVARRTSRQSSGWVSEFEGISERRRR 160
+ERR R R+S G S+ EG ++ R
Sbjct: 65 HERR---RERKRRSRGRRSDSEGEQRQKSR 91


>sp|Q5U4C3|SFR19_MOUSE Splicing factor, arginine/serine-rich 19
OS=Mus musculus GN=Scaf1 PE=1 SV=1
Length = 1256

Score = 35.8 bits (81), Expect = 0.11
Identities = 37/130 (28%), Positives = 51/130 (39%)
Frame = -2

Query: 471 RRTRDREGQHRDQYGAQVGWDWRSRKWIDGVHGSSLSGRQQKFHLSRQRQRENSADESID 292
RR R R G W+ + + + GS + R++ SR+R R SAD
Sbjct: 504 RRERQRSGDPAPPDSPS--WEAKKHRSRERKLGSHSTARRRSRSRSRRRSRSRSADRRRG 561

Query: 291 GRISRLRQDANRLVNERRLVARRTSRQSSGWVSEFEGISERRRRDGYGVETLTRIKREKV 112
G SR R+ R RR A SS S E +RR G + +R + EK
Sbjct: 562 GHRSRSREKRRR----RRRSASPPPAASSSSSSRRERHRGKRREGGKKKKKRSRSRAEKR 617

Query: 111 GGPRGRRRAS 82
G + AS
Sbjct: 618 SGDLEKLPAS 627


>sp|Q9WTV7|RNF12_MOUSE E3 ubiquitin-protein ligase RNF12 OS=Mus
musculus GN=Rnf12 PE=1 SV=1
Length = 600

Score = 35.4 bits (80), Expect = 0.14
Identities = 30/100 (30%), Positives = 40/100 (40%), Gaps = 12/100 (12%)
Frame = -2

Query: 336 SRQRQRENSADESIDGRISRLRQDANRLVNE------------RRLVARRTSRQSSGWVS 193
S QRQ ENSA ES R SR +++ V E R RRT ++ +S
Sbjct: 170 SSQRQMENSASESASARPSRAERNSTEAVTEVPTTRAQRRARSRSPEHRRTRARAERSMS 229

Query: 192 EFEGISERRRRDGYGVETLTRIKREKVGGPRGRRRASHHV 73
+ SE RR +++ P G R HHV
Sbjct: 230 PLQPTSEIPRR-------APTLEQSSENEPEGSSRTRHHV 262


>sp|Q8H0U8|RH42_ARATH DEAD-box ATP-dependent RNA helicase 42
OS=Arabidopsis thaliana GN=RH42 PE=2 SV=2
Length = 1166

Score = 35.0 bits (79), Expect = 0.19
Identities = 38/160 (23%), Positives = 66/160 (41%), Gaps = 2/160 (1%)
Frame = -2

Query: 492 DEEQLALRRTRDREGQHRDQYGAQVGWDWRSRKWIDGVHGSSLSGRQQKFHLSRQRQ--R 319
D+E+ R+ ++RE + RD+ +V RK D + K ++ + + R
Sbjct: 67 DDEEREKRKEKERERRRRDK--DRVKRRSERRKSSDSEDDVEEEDERDKRRVNEKERGHR 124

Query: 318 ENSADESIDGRISRLRQDANRLVNERRLVARRTSRQSSGWVSEFEGISERRRRDGYGVET 139
E+ D D + R R++ R ER R R+ E E + ER RR+ E
Sbjct: 125 EHERDRGKDRKRDREREE--RKDKEREREKDRERREREREEREKERVKERERREREDGER 182

Query: 138 LTRIKREKVGGPRGRRRASHHVLDLHNRRKLMRREFQLRR 19
R + ++ G R R R + ++R+ + RR
Sbjct: 183 DRREREKERGSRRNRERERSREVGNEESDDDVKRDLKRRR 222


tr_hit_id B4M847
Definition tr|B4M847|B4M847_DROVI GJ16673 OS=Drosophila virilis
Align length 141
Score (bit) 43.1
E-value 0.007
Report
BLASTX 2.2.19 [Nov-02-2008]


Reference: Altschul, Stephen F., Thomas L. Madden, Alejandro A. Schaffer,
Jinghui Zhang, Zheng Zhang, Webb Miller, and David J. Lipman (1997),
"Gapped BLAST and PSI-BLAST: a new generation of protein database search
programs", Nucleic Acids Res. 25:3389-3402.

Query= BP918329|Adiantum capillus-veneris mRNA, clone:
YMU001_000112_C03.
(493 letters)

Database: uniprot_trembl.fasta
7,341,751 sequences; 2,391,615,440 total letters

Searching..................................................done



Score E
Sequences producing significant alignments: (bits) Value

tr|B4M847|B4M847_DROVI GJ16673 OS=Drosophila virilis GN=GJ16673 ... 43 0.007
tr|Q1LUX7|Q1LUX7_DANRE Novel protein similar to mouse and human ... 39 0.13
tr|Q08BL8|Q08BL8_DANRE Si:dkey-7l12.4 protein OS=Danio rerio GN=... 39 0.13
tr|B4N2I8|B4N2I8_DROWI GK16115 OS=Drosophila willistoni GN=GK161... 39 0.17
tr|B0CNI2|B0CNI2_LACBS Predicted protein OS=Laccaria bicolor (st... 39 0.17
tr|Q3KBU5|Q3KBU5_PSEPF Putative uncharacterized protein OS=Pseud... 38 0.23
tr|Q5F1X9|Q5F1X9_ORYSJ Putative uncharacterized protein B1642C07... 38 0.30
tr|Q95ZY7|Q95ZY7_CAEEL Apical junction molecule protein 1, isofo... 38 0.30
tr|Q8MQC7|Q8MQC7_CAEEL Apical junction molecule protein 1, isofo... 38 0.30
tr|Q18138|Q18138_CAEEL Apical junction molecule protein 1, isofo... 38 0.30
tr|Q18137|Q18137_CAEEL Apical junction molecule protein 1, isofo... 38 0.30
tr|A1TZT7|A1TZT7_MARAV Condensin subunit Smc OS=Marinobacter aqu... 37 0.39
tr|Q3JWW0|Q3JWW0_BURP1 Putative uncharacterized protein OS=Burkh... 37 0.51
tr|Q7X8Y1|Q7X8Y1_ORYSJ Os04g0530300 protein OS=Oryza sativa subs... 37 0.51
tr|B8BQG0|B8BQG0_THAPS Predicted protein OS=Thalassiosira pseudo... 37 0.51
tr|B8ASD2|B8ASD2_ORYSI Putative uncharacterized protein OS=Oryza... 37 0.51
tr|A3AVT6|A3AVT6_ORYSJ Putative uncharacterized protein OS=Oryza... 37 0.51
tr|B6KQC9|B6KQC9_TOXGO Putative uncharacterized protein OS=Toxop... 37 0.66
tr|Q7N981|Q7N981_PHOLL Similarities with VgrG and VgrE proteins ... 36 0.84
tr|A1L013|A1L013_MOUSE Cactin (RIKEN cDNA 2510012J08 gene) OS=Mu... 36 0.86
tr|B7Q9H7|B7Q9H7_IXOSC Coiled-coil domain-containing protein, pu... 36 0.86
tr|Q8CE02|Q8CE02_MOUSE Putative uncharacterized protein OS=Mus m... 36 1.1
tr|B6PHS6|B6PHS6_BRAFL Putative uncharacterized protein (Fragmen... 36 1.1
tr|A4I141|A4I141_LEIIN Putative uncharacterized protein OS=Leish... 36 1.1
tr|A2QFA2|A2QFA2_ASPNC Similarity to tight junction protein ZO-1... 36 1.1
tr|Q9CYY2|Q9CYY2_MOUSE Putative uncharacterized protein OS=Mus m... 35 1.5
tr|Q91X19|Q91X19_MOUSE Ring finger protein 12 OS=Mus musculus GN... 35 1.5
tr|Q6H253|Q6H253_9BURK Putative uncharacterized protein OS=Burkh... 35 1.5
tr|B4I0J1|B4I0J1_DROSE GM12438 OS=Drosophila sechellia GN=GM1243... 35 1.5
tr|Q7SGQ8|Q7SGQ8_NEUCR Putative uncharacterized protein OS=Neuro... 35 1.5

>tr|B4M847|B4M847_DROVI GJ16673 OS=Drosophila virilis GN=GJ16673
PE=4 SV=1
Length = 404

Score = 43.1 bits (100), Expect = 0.007
Identities = 39/141 (27%), Positives = 65/141 (46%), Gaps = 22/141 (15%)
Frame = -2

Query: 357 RQQKFHLSRQRQRENSADESIDGR------------------ISRLRQDANRL----VNE 244
R+Q+ L +QR++ N+A E + G+ IS+LRQ+ RL + E
Sbjct: 97 REQQLRLQQQREQLNAA-EQLQGQQQQRMNETLETLCISQDCISQLRQEQQRLQQQSLEE 155

Query: 243 RRLVARRTSRQSSGWVSEFEGISERRRRDGYGVETLTRIKREKVGGPRGRRRASHHVLDL 64
RL+ +R +Q V E + +R R+ ++ RI E+ R RR HH+L L
Sbjct: 156 MRLLQQRLRQQRQQGVEEMRLLQQRHRQQRMALQ--QRIDDEE-RTDRQRRLDQHHILQL 212

Query: 63 HNRRKLMRREFQLRRDTSMRR 1
++ R + QL+ +R
Sbjct: 213 RTLQQHRREQKQLQTQQQQQR 233


>tr|Q1LUX7|Q1LUX7_DANRE Novel protein similar to mouse and human
splicing factor, arginine/serine-rich 16
(Suppressor-of-white-apricot homolog, Drosophila)
(SFRS16) OS=Danio rerio GN=si:dkey-7l12.4 PE=4 SV=1
Length = 642

Score = 38.9 bits (89), Expect = 0.13
Identities = 37/124 (29%), Positives = 50/124 (40%)
Frame = -2

Query: 372 SSLSGRQQKFHLSRQRQRENSADESIDGRISRLRQDANRLVNERRLVARRTSRQSSGWVS 193
SS S R SR R + S GR R +R + RR +R SRQ SG
Sbjct: 370 SSFSSRSSSHRSSRSSSRSRRSRRSRGGRDRDSRYSRSRSRSRRRSDSR--SRQRSG--- 424

Query: 192 EFEGISERRRRDGYGVETLTRIKREKVGGPRGRRRASHHVLDLHNRRKLMRREFQLRRDT 13
G+S RRR D ++ R + RGRR +R + + R Q R +
Sbjct: 425 ---GVSSRRRYDRTRSRSVDRGRDRNRDRDRGRRYTGRRRTRSRSRSRSVDRYRQRSRSS 481

Query: 12 SMRR 1
+ RR
Sbjct: 482 AYRR 485


>tr|Q08BL8|Q08BL8_DANRE Si:dkey-7l12.4 protein OS=Danio rerio
GN=si:dkey-7l12.4 PE=2 SV=1
Length = 560

Score = 38.9 bits (89), Expect = 0.13
Identities = 37/124 (29%), Positives = 50/124 (40%)
Frame = -2

Query: 372 SSLSGRQQKFHLSRQRQRENSADESIDGRISRLRQDANRLVNERRLVARRTSRQSSGWVS 193
SS S R SR R + S GR R +R + RR +R SRQ SG
Sbjct: 370 SSFSSRSSSHRSSRSSSRSRRSRRSRGGRDRDSRYSRSRSRSRRRSDSR--SRQRSG--- 424

Query: 192 EFEGISERRRRDGYGVETLTRIKREKVGGPRGRRRASHHVLDLHNRRKLMRREFQLRRDT 13
G+S RRR D ++ R + RGRR +R + + R Q R +
Sbjct: 425 ---GVSSRRRYDRTRSRSVDRGRDRNRDRDRGRRYTGRRRTRSRSRSRSVDRYRQRSRSS 481

Query: 12 SMRR 1
+ RR
Sbjct: 482 AYRR 485


>tr|B4N2I8|B4N2I8_DROWI GK16115 OS=Drosophila willistoni GN=GK16115
PE=4 SV=1
Length = 654

Score = 38.5 bits (88), Expect = 0.17
Identities = 35/164 (21%), Positives = 76/164 (46%), Gaps = 1/164 (0%)
Frame = -2

Query: 489 EEQLALRRTRDREGQHRDQYGAQVGWDWR-SRKWIDGVHGSSLSGRQQKFHLSRQRQREN 313
E+Q+ ++T+ ++ Q ++Q +Q + + S+K + + +K S +
Sbjct: 399 EQQIKKKKTQQQQQQQQEQEISQDEHETKPSKKPTSSSSSVEPTKKPKKPRPSSSSSSSS 458

Query: 312 SADESIDGRISRLRQDANRLVNERRLVARRTSRQSSGWVSEFEGISERRRRDGYGVETLT 133
S+ S I++ + + +++ +R SR SSG S +++RRRR +++
Sbjct: 459 SSSSSSSSSINKRKPKPQQQQQQQK--KKRKSRPSSGSSSN-SSVNKRRRRPSSSSSSIS 515

Query: 132 RIKREKVGGPRGRRRASHHVLDLHNRRKLMRREFQLRRDTSMRR 1
+ G RRR+S+ ++ + RR+ Q ++D RR
Sbjct: 516 GSSSSRPIGGYRRRRSSYQSSQSTSQEQRRRRQKQRKQDEKRRR 559


>tr|B0CNI2|B0CNI2_LACBS Predicted protein OS=Laccaria bicolor (strain
S238N-H82) GN=LACBIDRAFT_291789 PE=4 SV=1
Length = 1061

Score = 38.5 bits (88), Expect = 0.17
Identities = 44/167 (26%), Positives = 67/167 (40%), Gaps = 3/167 (1%)
Frame = -2

Query: 492 DEEQLALRRTRDR-EGQHRDQYGAQVGWDWRSRKWIDGVHGSSLSGRQQKFHLSRQRQRE 316
DEE+ RRTR R + + + A+ G SR D +S Q++ SR+ Q
Sbjct: 613 DEEEAYGRRTRRRYRSRSKSKERAKEGKHHSSRSHADRDDLTSRRSHQERSRTSRREQPG 672

Query: 315 NSADESIDGRISRLRQDANRLVNERRLVARRTSRQSSGWVSEFEGISERRRRDGYGVETL 136
+S++ ++ ++R R+SR S G IS RR L
Sbjct: 673 ERDRDSLERDEEDHKRHRRHRSRDKRSRRGRSSRHSLG-------ISSPRRS-----RPL 720

Query: 135 TRIKREKVGGPRGRRRASHHVL--DLHNRRKLMRREFQLRRDTSMRR 1
+ + E+ P+ R + S DLHN RR RR +RR
Sbjct: 721 SSSRTEESISPKNREKRSQKYALDDLHNETPSPRRSLSPRRSPFLRR 767


>tr|Q3KBU5|Q3KBU5_PSEPF Putative uncharacterized protein
OS=Pseudomonas fluorescens (strain Pf0-1) GN=Pf01_3021
PE=3 SV=1
Length = 504

Score = 38.1 bits (87), Expect = 0.23
Identities = 20/55 (36%), Positives = 32/55 (58%), Gaps = 3/55 (5%)
Frame = -2

Query: 336 SRQRQRENSADESID---GRISRLRQDANRLVNERRLVARRTSRQSSGWVSEFEG 181
+R R+RENS D I G +++ + R NE RL A + SRQ+ G +++ +G
Sbjct: 93 NRLRERENSVDSRIQTALGSVTQQVDEGRRQANEARLKAEQDSRQARGLLTQLQG 147


>tr|Q5F1X9|Q5F1X9_ORYSJ Putative uncharacterized protein B1642C07.43
OS=Oryza sativa subsp. japonica GN=B1642C07.43 PE=4 SV=1
Length = 151

Score = 37.7 bits (86), Expect = 0.30
Identities = 19/56 (33%), Positives = 26/56 (46%)
Frame = -2

Query: 456 REGQHRDQYGAQVGWDWRSRKWIDGVHGSSLSGRQQKFHLSRQRQRENSADESIDG 289
R + RD GA GW WR + G HG G ++ R+R RE A ++ G
Sbjct: 47 RRRRGRDNGGAHGGWQWRRGRDSGGAHGGWPGGASTEWEGQRRRAREEVAARTVAG 102


>tr|Q95ZY7|Q95ZY7_CAEEL Apical junction molecule protein 1, isoform
c OS=Caenorhabditis elegans GN=ajm-1 PE=2 SV=1
Length = 1148

Score = 37.7 bits (86), Expect = 0.30
Identities = 43/167 (25%), Positives = 68/167 (40%), Gaps = 4/167 (2%)
Frame = -2

Query: 489 EEQLALRRTRDREGQHRDQYGAQVGWDWRSRKWIDGVHGSSLSGRQQKFHLSRQRQRENS 310
E LA R D+E +++ Q R +W D + L+ + + R ++E
Sbjct: 315 ERALAERERADKERLQQERLLRQQREKKRREEW-DRLESIRLAEEEAELARRRALEKERI 373

Query: 309 ADESIDGR---ISRLRQDANRLVNERRLVARRTSRQSSGWVSEFEGIS-ERRRRDGYGVE 142
E + + RL ++ RL ER RR ++ E E I ERR + +E
Sbjct: 374 DREKAEEERKTMERLERERARLERERLEEERRQKEKA-----ETERIERERREHERIEIE 428

Query: 141 TLTRIKREKVGGPRGRRRASHHVLDLHNRRKLMRREFQLRRDTSMRR 1
+ RIKRE++ R R D +L+R +L R RR
Sbjct: 429 RIERIKRERIERERREREEKKAEED-----RLLRERLELERIERERR 470



Score = 32.7 bits (73), Expect = 9.5
Identities = 36/172 (20%), Positives = 69/172 (40%), Gaps = 9/172 (5%)
Frame = -2

Query: 489 EEQLALRRTRDREGQHRDQYGAQVGW---DWRSRKWIDGVHGSSLSGRQQKFHLSRQRQR 319
E +L R DRE Q + ++ + R + + VH + +++ L ++++R
Sbjct: 479 ELELQRREAEDRERQRLEDEAREMRRREEERREAELVADVHRQA----EERERLRKRQER 534

Query: 318 ENSADESIDGRISRLRQDANRLVNERRLVARRTSRQSSGWVSEFEGISERRR------RD 157
E + R+ R+R + ++ ER RR + EFE I RR RD
Sbjct: 535 EEAE------RLERIRLEQQKIDMERIDAERRERERKEEERREFELIEAARRKKEARDRD 588

Query: 156 GYGVETLTRIKREKVGGPRGRRRASHHVLDLHNRRKLMRREFQLRRDTSMRR 1
R++ E+ + RR + R++ E ++ R ++R
Sbjct: 589 RLDEMERERVREEEERREKERREQERRIAAEKERKRRQEEEEEIARLNELQR 640


>tr|Q8MQC7|Q8MQC7_CAEEL Apical junction molecule protein 1, isoform
d OS=Caenorhabditis elegans GN=ajm-1 PE=2 SV=1
Length = 1439

Score = 37.7 bits (86), Expect = 0.30
Identities = 43/167 (25%), Positives = 68/167 (40%), Gaps = 4/167 (2%)
Frame = -2

Query: 489 EEQLALRRTRDREGQHRDQYGAQVGWDWRSRKWIDGVHGSSLSGRQQKFHLSRQRQRENS 310
E LA R D+E +++ Q R +W D + L+ + + R ++E
Sbjct: 315 ERALAERERADKERLQQERLLRQQREKKRREEW-DRLESIRLAEEEAELARRRALEKERI 373

Query: 309 ADESIDGR---ISRLRQDANRLVNERRLVARRTSRQSSGWVSEFEGIS-ERRRRDGYGVE 142
E + + RL ++ RL ER RR ++ E E I ERR + +E
Sbjct: 374 DREKAEEERKTMERLERERARLERERLEEERRQKEKA-----ETERIERERREHERIEIE 428

Query: 141 TLTRIKREKVGGPRGRRRASHHVLDLHNRRKLMRREFQLRRDTSMRR 1
+ RIKRE++ R R D +L+R +L R RR
Sbjct: 429 RIERIKRERIERERREREEKKAEED-----RLLRERLELERIERERR 470



Score = 32.7 bits (73), Expect = 9.5
Identities = 36/172 (20%), Positives = 69/172 (40%), Gaps = 9/172 (5%)
Frame = -2

Query: 489 EEQLALRRTRDREGQHRDQYGAQVGW---DWRSRKWIDGVHGSSLSGRQQKFHLSRQRQR 319
E +L R DRE Q + ++ + R + + VH + +++ L ++++R
Sbjct: 479 ELELQRREAEDRERQRLEDEAREMRRREEERREAELVADVHRQA----EERERLRKRQER 534

Query: 318 ENSADESIDGRISRLRQDANRLVNERRLVARRTSRQSSGWVSEFEGISERRR------RD 157
E + R+ R+R + ++ ER RR + EFE I RR RD
Sbjct: 535 EEAE------RLERIRLEQQKIDMERIDAERRERERKEEERREFELIEAARRKKEARDRD 588

Query: 156 GYGVETLTRIKREKVGGPRGRRRASHHVLDLHNRRKLMRREFQLRRDTSMRR 1
R++ E+ + RR + R++ E ++ R ++R
Sbjct: 589 RLDEMERERVREEEERREKERREQERRIAAEKERKRRQEEEEEIARLNELQR 640


>tr|Q18138|Q18138_CAEEL Apical junction molecule protein 1, isoform
a OS=Caenorhabditis elegans GN=ajm-1 PE=2 SV=2
Length = 1480

Score = 37.7 bits (86), Expect = 0.30
Identities = 43/167 (25%), Positives = 68/167 (40%), Gaps = 4/167 (2%)
Frame = -2

Query: 489 EEQLALRRTRDREGQHRDQYGAQVGWDWRSRKWIDGVHGSSLSGRQQKFHLSRQRQRENS 310
E LA R D+E +++ Q R +W D + L+ + + R ++E
Sbjct: 315 ERALAERERADKERLQQERLLRQQREKKRREEW-DRLESIRLAEEEAELARRRALEKERI 373

Query: 309 ADESIDGR---ISRLRQDANRLVNERRLVARRTSRQSSGWVSEFEGIS-ERRRRDGYGVE 142
E + + RL ++ RL ER RR ++ E E I ERR + +E
Sbjct: 374 DREKAEEERKTMERLERERARLERERLEEERRQKEKA-----ETERIERERREHERIEIE 428

Query: 141 TLTRIKREKVGGPRGRRRASHHVLDLHNRRKLMRREFQLRRDTSMRR 1
+ RIKRE++ R R D +L+R +L R RR
Sbjct: 429 RIERIKRERIERERREREEKKAEED-----RLLRERLELERIERERR 470



Score = 32.7 bits (73), Expect = 9.5
Identities = 36/172 (20%), Positives = 69/172 (40%), Gaps = 9/172 (5%)
Frame = -2

Query: 489 EEQLALRRTRDREGQHRDQYGAQVGW---DWRSRKWIDGVHGSSLSGRQQKFHLSRQRQR 319
E +L R DRE Q + ++ + R + + VH + +++ L ++++R
Sbjct: 479 ELELQRREAEDRERQRLEDEAREMRRREEERREAELVADVHRQA----EERERLRKRQER 534

Query: 318 ENSADESIDGRISRLRQDANRLVNERRLVARRTSRQSSGWVSEFEGISERRR------RD 157
E + R+ R+R + ++ ER RR + EFE I RR RD
Sbjct: 535 EEAE------RLERIRLEQQKIDMERIDAERRERERKEEERREFELIEAARRKKEARDRD 588

Query: 156 GYGVETLTRIKREKVGGPRGRRRASHHVLDLHNRRKLMRREFQLRRDTSMRR 1
R++ E+ + RR + R++ E ++ R ++R
Sbjct: 589 RLDEMERERVREEEERREKERREQERRIAAEKERKRRQEEEEEIARLNELQR 640