BP918334
Clone id YMU001_000112_C08
Library
Length 517
Definition Adiantum capillus-veneris mRNA. clone: YMU001_000112_C08.
Accession
Tissue type prothallium
Developmental stage -
Contig ID
Sequence
GCCGCCACAGTTTCTTCAGGGAACTAGATCGTTGTCTGCATATACTTCTCAAGACATCAA
TATCAAGCTCCCCATTGTTACCACAAAAAGACCAGCTTCCGCGAACCATCCATTGCCCAG
ACATCTCATCCCACTCCTGGGACACTCTTACATCTTTGATGGAGCATAAGAGCTCGTCTC
CTTCTTCTGGAAAGAGAATCTTGACCTTGAAATCTTTATCCCTGGTAATTATGTCGTGTA
AAAGAACGCCCTCCCACCATGCATATTCATAGAAGGCATCAACTAAAAGACCTTTTTTTG
GACTTTTAAATGAAGATATACAGTAAGCAGGCGGCAATGGCCGAATAAATCCTCTTCTTG
TGGGATCAACTGAAGTTGAAGGCTTCTGACAATTATTCTCGTTCAGAGGTATTATCTCCT
GTAATTTCTTTCTTCCATCTCGAGTTAGTAACTCGTCATATTCCACTATTCTGCGACCAT
CCTTCACTTGCACTACTACACCTGGATGCCAAGAACC
■■Homology search results ■■ -
sp_hit_id Q5ZM30
Definition sp|Q5ZM30|RPR1A_CHICK Regulation of nuclear pre-mRNA domain-containing protein 1A OS=Gallus gallus
Align length 57
Score (bit) 33.5
E-value 0.61
Report
BLASTX 2.2.19 [Nov-02-2008]


Reference: Altschul, Stephen F., Thomas L. Madden, Alejandro A. Schaffer,
Jinghui Zhang, Zheng Zhang, Webb Miller, and David J. Lipman (1997),
"Gapped BLAST and PSI-BLAST: a new generation of protein database search
programs", Nucleic Acids Res. 25:3389-3402.

Query= BP918334|Adiantum capillus-veneris mRNA, clone:
YMU001_000112_C08.
(517 letters)

Database: uniprot_sprot.fasta
412,525 sequences; 148,809,765 total letters

Searching..................................................done



Score E
Sequences producing significant alignments: (bits) Value

sp|Q5ZM30|RPR1A_CHICK Regulation of nuclear pre-mRNA domain-cont... 33 0.61
sp|Q8RBH4|HUTH_THETN Histidine ammonia-lyase OS=Thermoanaerobact... 32 2.3
sp|Q7MGP6|GPPA_VIBVY Guanosine-5'-triphosphate,3'-diphosphate py... 31 3.0
sp|Q8DDN5|GPPA_VIBVU Guanosine-5'-triphosphate,3'-diphosphate py... 31 3.0
sp|Q5UQC0|YL226_MIMIV Uncharacterized protein L226 OS=Acanthamoe... 31 4.0
sp|Q8TEX9|IPO4_HUMAN Importin-4 OS=Homo sapiens GN=IPO4 PE=1 SV=2 30 5.1
sp|Q53EP0|FND3B_HUMAN Fibronectin type III domain-containing pro... 30 5.2
sp|A7MXT2|GPPA_VIBHB Guanosine-5'-triphosphate,3'-diphosphate py... 30 6.7
sp|Q9KV53|GPPA_VIBCH Guanosine-5'-triphosphate,3'-diphosphate py... 30 6.7
sp|A5F3R3|GPPA_VIBC3 Guanosine-5'-triphosphate,3'-diphosphate py... 30 6.7
sp|Q8VDM1|ZGPAT_MOUSE Zinc finger CCCH-type with G patch domain-... 30 8.8
sp|A1USB4|GATB_BARBK Aspartyl/glutamyl-tRNA(Asn/Gln) amidotransf... 30 8.8
sp|Q6NWW9|FND3B_MOUSE Fibronectin type III domain-containing pro... 30 8.8

>sp|Q5ZM30|RPR1A_CHICK Regulation of nuclear pre-mRNA
domain-containing protein 1A OS=Gallus gallus GN=RPRD1A
PE=2 SV=1
Length = 268

Score = 33.5 bits (75), Expect = 0.61
Identities = 20/57 (35%), Positives = 28/57 (49%), Gaps = 8/57 (14%)
Frame = -1

Query: 508 HPGVVVQVKDGRRIVEYDELLT--------RDGRKKLQEIIPLNENNCQKPSTSVDP 362
HPG V+ + + R + E D L R RK+ E I ++ENNC S+ DP
Sbjct: 103 HPGRVLSIWEERSVYENDVLEQLRQALYGDRKVRKRTYEQIKVDENNCSPRSSPTDP 159


>sp|Q8RBH4|HUTH_THETN Histidine ammonia-lyase OS=Thermoanaerobacter
tengcongensis GN=hutH PE=3 SV=1
Length = 508

Score = 31.6 bits (70), Expect = 2.3
Identities = 14/35 (40%), Positives = 22/35 (62%)
Frame = -1

Query: 508 HPGVVVQVKDGRRIVEYDELLTRDGRKKLQEIIPL 404
H G +V K+ R++VE EL+TR G ++Q+ L
Sbjct: 247 HKGQIVSAKNVRKMVEGSELITRQGEIRVQDAYTL 281


>sp|Q7MGP6|GPPA_VIBVY Guanosine-5'-triphosphate,3'-diphosphate
pyrophosphatase OS=Vibrio vulnificus (strain YJ016)
GN=gppA PE=3 SV=2
Length = 497

Score = 31.2 bits (69), Expect = 3.0
Identities = 20/45 (44%), Positives = 29/45 (64%)
Frame = +3

Query: 120 DISSHSWDTLTSLMEHKSSSPSSGKRILTLKSLSLVIMSCKRTPS 254
+I+ + LTSL E + S +SGKR+L L L+ VI+S +R PS
Sbjct: 402 EIARRYREGLTSLPEQHALSGNSGKRLLRLLRLA-VILSHRRQPS 445


>sp|Q8DDN5|GPPA_VIBVU Guanosine-5'-triphosphate,3'-diphosphate
pyrophosphatase OS=Vibrio vulnificus GN=gppA PE=3 SV=1
Length = 497

Score = 31.2 bits (69), Expect = 3.0
Identities = 20/45 (44%), Positives = 29/45 (64%)
Frame = +3

Query: 120 DISSHSWDTLTSLMEHKSSSPSSGKRILTLKSLSLVIMSCKRTPS 254
+I+ + LTSL E + S +SGKR+L L L+ VI+S +R PS
Sbjct: 402 EIARRYREGLTSLPEQHALSGNSGKRLLRLLRLA-VILSHRRQPS 445


>sp|Q5UQC0|YL226_MIMIV Uncharacterized protein L226 OS=Acanthamoeba
polyphaga mimivirus GN=MIMI_L226 PE=4 SV=1
Length = 690

Score = 30.8 bits (68), Expect = 4.0
Identities = 18/61 (29%), Positives = 29/61 (47%), Gaps = 2/61 (3%)
Frame = -1

Query: 454 ELLTRDGRKKLQEII--PLNENNCQKPSTSVDPTRRGFIRPLPPAYCISSFKSPKKGLLV 281
E T G + E+I LN++N P + D + G I + P Y + +K P +L+
Sbjct: 300 EYFTEKGFEPTDEMIVNKLNDSNKSTPKINNDSSSFGTIMIMTPDYSFTRYKPPYYSILI 359

Query: 280 D 278
D
Sbjct: 360 D 360


>sp|Q8TEX9|IPO4_HUMAN Importin-4 OS=Homo sapiens GN=IPO4 PE=1 SV=2
Length = 1081

Score = 30.4 bits (67), Expect = 5.1
Identities = 21/69 (30%), Positives = 30/69 (43%)
Frame = +3

Query: 135 SWDTLTSLMEHKSSSPSSGKRILTLKSLSLVIMSCKRTPSHHAYS*KASTKRPFFGLLNE 314
+W L L++H + SP S +R + L LS+V+ S H R LLNE
Sbjct: 115 AWPQLLQLLQHSTHSPHSPEREMGLLLLSVVVTSRPEAFQPH--------HRELLRLLNE 166

Query: 315 DIQ*AGGNG 341
+ G G
Sbjct: 167 TLGEVGSPG 175


>sp|Q53EP0|FND3B_HUMAN Fibronectin type III domain-containing
protein 3B OS=Homo sapiens GN=FNDC3B PE=1 SV=2
Length = 1204

Score = 30.4 bits (67), Expect = 5.2
Identities = 26/100 (26%), Positives = 46/100 (46%)
Frame = -1

Query: 430 KKLQEIIPLNENNCQKPSTSVDPTRRGFIRPLPPAYCISSFKSPKKGLLVDAFYEYAWWE 251
K++Q+I+ + +KP S R + PP + P GL YE A
Sbjct: 270 KRVQDIL----SGIEKPQVSNIQARAVVLSWAPP---VGLSCGPHSGLSFPYSYEVA--- 319

Query: 250 GVLLHDIITRDKDFKVKILFPEEGDELLCSIKDVRVSQEW 131
+ + +D K KI++ G+EL C++KD+R + ++
Sbjct: 320 ------LSDKGRDGKYKIIY--SGEELECNLKDLRPATDY 351


>sp|A7MXT2|GPPA_VIBHB Guanosine-5'-triphosphate,3'-diphosphate
pyrophosphatase OS=Vibrio harveyi (strain ATCC BAA-1116
/ BB120) GN=gppA PE=3 SV=1
Length = 497

Score = 30.0 bits (66), Expect = 6.7
Identities = 18/44 (40%), Positives = 28/44 (63%)
Frame = +3

Query: 120 DISSHSWDTLTSLMEHKSSSPSSGKRILTLKSLSLVIMSCKRTP 251
+I+ + LTSL E + S +SGKR+L L L+ V++S +R P
Sbjct: 402 EIARRYREQLTSLPEQHALSGTSGKRVLRLLRLA-VLLSHRRNP 444


>sp|Q9KV53|GPPA_VIBCH Guanosine-5'-triphosphate,3'-diphosphate
pyrophosphatase OS=Vibrio cholerae GN=gppA PE=3 SV=1
Length = 497

Score = 30.0 bits (66), Expect = 6.7
Identities = 17/38 (44%), Positives = 27/38 (71%)
Frame = +3

Query: 141 DTLTSLMEHKSSSPSSGKRILTLKSLSLVIMSCKRTPS 254
+ LTSL E + S +SGKR+L L L+ V++S +R+P+
Sbjct: 409 EQLTSLPEQYALSGTSGKRVLRLLRLA-VLLSHRRSPA 445


>sp|A5F3R3|GPPA_VIBC3 Guanosine-5'-triphosphate,3'-diphosphate
pyrophosphatase OS=Vibrio cholerae serotype O1 (strain
ATCC 39541 / Ogawa 395 / O395) GN=gppA PE=3 SV=1
Length = 497

Score = 30.0 bits (66), Expect = 6.7
Identities = 17/38 (44%), Positives = 27/38 (71%)
Frame = +3

Query: 141 DTLTSLMEHKSSSPSSGKRILTLKSLSLVIMSCKRTPS 254
+ LTSL E + S +SGKR+L L L+ V++S +R+P+
Sbjct: 409 EQLTSLPEQYALSGTSGKRVLRLLRLA-VLLSHRRSPA 445


tr_hit_id Q9LUZ5|Q9LUZ5_ARATH Gb
Definition tr|Q9LUZ5|Q9LUZ5_ARATH Gb|AAC80581.1 OS=Arabidopsis thaliana
Align length 177
Score (bit) 98.2
E-value 2.0e-19
Report
BLASTX 2.2.19 [Nov-02-2008]


Reference: Altschul, Stephen F., Thomas L. Madden, Alejandro A. Schaffer,
Jinghui Zhang, Zheng Zhang, Webb Miller, and David J. Lipman (1997),
"Gapped BLAST and PSI-BLAST: a new generation of protein database search
programs", Nucleic Acids Res. 25:3389-3402.

Query= BP918334|Adiantum capillus-veneris mRNA, clone:
YMU001_000112_C08.
(517 letters)

Database: uniprot_trembl.fasta
7,341,751 sequences; 2,391,615,440 total letters

Searching..................................................done



Score E
Sequences producing significant alignments: (bits) Value

tr|Q9LUZ5|Q9LUZ5_ARATH Gb|AAC80581.1 OS=Arabidopsis thaliana PE=... 98 2e-19
tr|A7NYD4|A7NYD4_VITVI Chromosome chr6 scaffold_3, whole genome ... 83 7e-15
tr|A9SIL7|A9SIL7_PHYPA Predicted protein OS=Physcomitrella paten... 65 2e-09
tr|A7Q0R2|A7Q0R2_VITVI Chromosome chr7 scaffold_42, whole genome... 60 6e-08
tr|A7P1Z6|A7P1Z6_VITVI Chromosome chr19 scaffold_4, whole genome... 57 5e-07
tr|A9SMF4|A9SMF4_PHYPA Predicted protein OS=Physcomitrella paten... 56 1e-06
tr|Q69J34|Q69J34_ORYSJ cDNA clone:J033106K01, full insert sequen... 54 4e-06
tr|Q0D4S5|Q0D4S5_ORYSJ Os07g0607300 protein OS=Oryza sativa subs... 54 4e-06
tr|A2YNJ7|A2YNJ7_ORYSI Putative uncharacterized protein OS=Oryza... 54 4e-06
tr|A9RX43|A9RX43_PHYPA Predicted protein OS=Physcomitrella paten... 54 6e-06
tr|A5BYW3|A5BYW3_VITVI Putative uncharacterized protein OS=Vitis... 54 6e-06
tr|Q9FM78|Q9FM78_ARATH Genomic DNA, chromosome 5, P1 clone:MDF20... 50 5e-05
tr|Q8W109|Q8W109_ARATH AT5g55600/MDF20_4 OS=Arabidopsis thaliana... 50 5e-05
tr|Q0WQ11|Q0WQ11_ARATH Putative uncharacterized protein At5g5560... 49 2e-04
tr|A7R4U7|A7R4U7_VITVI Chromosome undetermined scaffold_783, who... 48 3e-04
tr|A7P367|A7P367_VITVI Chromosome chr1 scaffold_5, whole genome ... 48 3e-04
tr|A5B418|A5B418_VITVI Putative uncharacterized protein OS=Vitis... 48 3e-04
tr|A7R7D9|A7R7D9_VITVI Chromosome undetermined scaffold_1717, wh... 48 3e-04
tr|Q9ZPZ3|Q9ZPZ3_ARATH T31J12.4 OS=Arabidopsis thaliana GN=T31J1... 47 4e-04
tr|Q67YH5|Q67YH5_ARATH Putative uncharacterized protein At1g0932... 47 4e-04
tr|Q500V5|Q500V5_ARATH At1g09320 OS=Arabidopsis thaliana PE=2 SV=1 47 4e-04
tr|B6U6Y1|B6U6Y1_MAIZE RNA binding protein OS=Zea mays PE=2 SV=1 47 4e-04
tr|Q6ZKB4|Q6ZKB4_ORYSJ Putative uncharacterized protein OJ1124_B... 44 0.004
tr|Q0J5J1|Q0J5J1_ORYSJ Os08g0431100 protein (Fragment) OS=Oryza ... 44 0.004
tr|A3BTD5|A3BTD5_ORYSJ Putative uncharacterized protein OS=Oryza... 44 0.004
tr|A2YVG7|A2YVG7_ORYSI Putative uncharacterized protein OS=Oryza... 44 0.004
tr|A7PRP1|A7PRP1_VITVI Chromosome chr14 scaffold_27, whole genom... 44 0.005
tr|B4FKF9|B4FKF9_MAIZE Putative uncharacterized protein OS=Zea m... 42 0.024
tr|Q2A9L5|Q2A9L5_BRAOL Agenet domain containing protein OS=Brass... 40 0.053
tr|A7Q958|A7Q958_VITVI Chromosome chr19 scaffold_66, whole genom... 40 0.053

>tr|Q9LUZ5|Q9LUZ5_ARATH Gb|AAC80581.1 OS=Arabidopsis thaliana PE=4
SV=1
Length = 1095

Score = 98.2 bits (243), Expect = 2e-19
Identities = 60/177 (33%), Positives = 91/177 (51%), Gaps = 6/177 (3%)
Frame = -1

Query: 517 GSWHPGVVVQVKDGRR-IVEYDELLTRDGRKKLQEIIPLNE-----NNCQKPSTSVDPTR 356
GSW+ G V K RR + YD +L+ DG L E + +++ ++C T V T
Sbjct: 43 GSWYLGTVTSAKKRRRRCIRYDNILSDDGSGNLVETVDVSDIVEGLDDC----TDVSDTF 98

Query: 355 RGFIRPLPPAYCISSFKSPKKGLLVDAFYEYAWWEGVLLHDIITRDKDFKVKILFPEEGD 176
RG +RP+PP ++ GL VD F+ AWWEGVL + K ++ FP+ GD
Sbjct: 99 RGRLRPVPPKLDVAKLNLAY-GLCVDVFFSDAWWEGVLFDH---ENGSEKRRVFFPDLGD 154

Query: 175 ELLCSIKDVRVSQEWDEMSGQWMVRGSWSFCGNNGELDIDVLRSICRQRSSSLKKLW 5
EL ++ +R++Q+W+E + W RGSW F LD+ + S+K+LW
Sbjct: 155 ELDADLQSLRITQDWNEATETWECRGSWLF------LDLIEIYKEYNYLPVSVKQLW 205


>tr|A7NYD4|A7NYD4_VITVI Chromosome chr6 scaffold_3, whole genome
shotgun sequence OS=Vitis vinifera GN=GSVIVT00024076001
PE=4 SV=1
Length = 1186

Score = 83.2 bits (204), Expect = 7e-15
Identities = 57/175 (32%), Positives = 89/175 (50%), Gaps = 4/175 (2%)
Frame = -1

Query: 517 GSWHPGVVVQVKDGRRIVEYDELLT-RDGRKKLQEIIPLNENNCQKPSTSVDPTR---RG 350
GSWH G ++ R V+Y E+L R G + L+ + + + + ++ VD + RG
Sbjct: 16 GSWHSGTIIGCDYLVRNVKYSEILDDRMGERFLESV---SVSGAIEGTSVVDTDQCNHRG 72

Query: 349 FIRPLPPAYCISSFKSPKKGLLVDAFYEYAWWEGVLLHDIITRDKDFKVKILFPEEGDEL 170
IRPLPP C + GL VD F+ AWWEGV+ D K+ FP+ GDEL
Sbjct: 73 RIRPLPPQ-CDFGKWNLHYGLCVDVFFREAWWEGVIFDH---EDGLENRKVFFPDLGDEL 128

Query: 169 LCSIKDVRVSQEWDEMSGQWMVRGSWSFCGNNGELDIDVLRSICRQRSSSLKKLW 5
+ ++R++Q+W+E + W R +W F E + D ++ SLK++W
Sbjct: 129 TVGVDNIRITQDWNEGTATWERRRNWLFLELIEEYEQDWPLNV------SLKQIW 177


>tr|A9SIL7|A9SIL7_PHYPA Predicted protein OS=Physcomitrella patens
subsp. patens GN=PHYPADRAFT_233467 PE=4 SV=1
Length = 945

Score = 65.5 bits (158), Expect = 2e-09
Identities = 50/151 (33%), Positives = 71/151 (47%), Gaps = 14/151 (9%)
Frame = -1

Query: 517 GSWHPGVVVQVKDGRRIVEYDELLTRDGRKKLQEIIPLNENNCQKPSTSVDPTRRGFIRP 338
G W G V+++ + V YDE+L DG K++E PL + PS S R +RP
Sbjct: 614 GGWFSGKVLRIDKVQAYVVYDEILDDDGSGKVKEWFPLKASG--PPSGS-----RRQVRP 666

Query: 337 LPPAYCISSFKSPKK------------GLLVDAFYEYAWWEG--VLLHDIITRDKDFKVK 200
L P I KS K+ G VDA+ E WWEG + L+D+ + KV
Sbjct: 667 LHPYSSIREAKSNKRQRIASGTRTWAVGECVDAYIEDGWWEGNIIELNDL----DEAKVT 722

Query: 199 ILFPEEGDELLCSIKDVRVSQEWDEMSGQWM 107
+ FP E D ++R S +WD+ G W+
Sbjct: 723 VYFPGEDDTQTVKTWNLRPSLQWDD--GVWV 751


>tr|A7Q0R2|A7Q0R2_VITVI Chromosome chr7 scaffold_42, whole genome
shotgun sequence OS=Vitis vinifera GN=GSVIVT00028148001
PE=4 SV=1
Length = 309

Score = 60.1 bits (144), Expect = 6e-08
Identities = 45/146 (30%), Positives = 67/146 (45%), Gaps = 9/146 (6%)
Frame = -1

Query: 517 GSWHPGVVVQV-------KDGRRIVEYDELLTRD-GRKKLQEIIPLNENNCQKPSTSVDP 362
G+W+ +++ K R +VEY +LL D G K L E++ +
Sbjct: 25 GAWYVATILESPPKSASKKRSRALVEYQDLLVDDVGSKPLTEVVDTS------------- 71

Query: 361 TRRGFIRPLPPAYCISSFKSPKKGLLVDAFYEYAWWEGVLLHDIITR-DKDFKVKILFPE 185
F+RPLPP ++F +VDAFY WW GV ITR +D K + F
Sbjct: 72 ----FLRPLPPPEADTNFCVND---IVDAFYRDGWWTGV-----ITRISEDSKCTVFFQN 119

Query: 184 EGDELLCSIKDVRVSQEWDEMSGQWM 107
DE+ D+RV +EW + G+W+
Sbjct: 120 PPDEIQFDRSDLRVHKEW--VDGKWI 143



Score = 40.4 bits (93), Expect = 0.053
Identities = 27/82 (32%), Positives = 38/82 (46%), Gaps = 2/82 (2%)
Frame = -1

Query: 346 IRPLPPAYCISSFKSPKKGLL--VDAFYEYAWWEGVLLHDIITRDKDFKVKILFPEEGDE 173
IRP PP + K GLL VDAFY+Y WW G++ + R + + F E
Sbjct: 213 IRPSPPR-----LEGRKFGLLEKVDAFYDYGWWNGIVTKVLTGR----RYVVFFKHTNME 263

Query: 172 LLCSIKDVRVSQEWDEMSGQWM 107
D+R EW + G+W+
Sbjct: 264 KEFIHSDLRPHMEW--VDGKWV 283


>tr|A7P1Z6|A7P1Z6_VITVI Chromosome chr19 scaffold_4, whole genome
shotgun sequence OS=Vitis vinifera GN=GSVIVT00027810001
PE=4 SV=1
Length = 160

Score = 57.0 bits (136), Expect = 5e-07
Identities = 44/140 (31%), Positives = 67/140 (47%), Gaps = 2/140 (1%)
Frame = -1

Query: 517 GSWHPGVVV-QVKDGRRIVEYDELLT-RDGRKKLQEIIPLNENNCQKPSTSVDPTRRGFI 344
GS++ V+ +V + +VEY LL+ DG++ L+EI+ E +
Sbjct: 45 GSYYEAKVLGKVGRNKLMVEYKTLLSDEDGQQPLKEIVEAAE-----------------V 87

Query: 343 RPLPPAYCISSFKSPKKGLLVDAFYEYAWWEGVLLHDIITRDKDFKVKILFPEEGDELLC 164
RP+PP ++ F+ VDAF WW G + +D K + F GDEL
Sbjct: 88 RPVPPVILVTGFEVLDT---VDAFDNDGWWVGRISGSY----EDGKYFVYFESSGDELAY 140

Query: 163 SIKDVRVSQEWDEMSGQWMV 104
I +RV QEW++ GQW+V
Sbjct: 141 PIHRLRVHQEWED--GQWLV 158


>tr|A9SMF4|A9SMF4_PHYPA Predicted protein OS=Physcomitrella patens
subsp. patens GN=PHYPADRAFT_165713 PE=4 SV=1
Length = 1061

Score = 55.8 bits (133), Expect = 1e-06
Identities = 47/157 (29%), Positives = 68/157 (43%), Gaps = 21/157 (13%)
Frame = -1

Query: 517 GSWHPGVVVQVKDGRRIVEYDELLTRD-------GRKKLQEIIPLNENNCQKPSTSVDPT 359
G W G ++ + V YDE+L D G K++E P PS+ P
Sbjct: 725 GGWFSGKILTATKTQACVVYDEILDDDVSGSHHVGVGKVEEWFPFKATG---PSSG--PR 779

Query: 358 RRGFIRPLPPAYCISSFKSPKK------------GLLVDAFYEYAWWEGVL--LHDIITR 221
R+ +RPL P + S K+ G VDAF + WWEG + L+D+
Sbjct: 780 RQ--VRPLHPYSSVREAGSKKRRRVALGSQTWAVGDYVDAFVQDGWWEGTITELNDL--- 834

Query: 220 DKDFKVKILFPEEGDELLCSIKDVRVSQEWDEMSGQW 110
+ KV + FP E D + D+R S +WD G+W
Sbjct: 835 -DETKVTVYFPGENDTQIVKTWDLRPSLQWD--GGKW 868


>tr|Q69J34|Q69J34_ORYSJ cDNA clone:J033106K01, full insert sequence
OS=Oryza sativa subsp. japonica GN=OSJNBa0072I06.22-1
PE=2 SV=1
Length = 636

Score = 54.3 bits (129), Expect = 4e-06
Identities = 36/120 (30%), Positives = 59/120 (49%), Gaps = 8/120 (6%)
Frame = -1

Query: 466 VEYDELLTRDGRKKLQEIIPLNENNCQKPSTSVDPTRRGF-------IRPLPPAYCISSF 308
V+YD+L D +L+E +P+ ST P + G +RP P ++
Sbjct: 416 VQYDDLQNADDSGRLEEWVPV--------STLARPDKLGLRCPERRRVRPRPQQNSLADG 467

Query: 307 KSPKKGLLVDAFYEYAWWEGVLLH-DIITRDKDFKVKILFPEEGDELLCSIKDVRVSQEW 131
+ G VD + WWEGVL+ D I+ D ++I FP E +C +K++R+S++W
Sbjct: 468 TNLLPGAAVDVWQFSGWWEGVLVSADNISAD---SLQIYFPGENFFSVCQLKNLRISKDW 524


>tr|Q0D4S5|Q0D4S5_ORYSJ Os07g0607300 protein OS=Oryza sativa subsp.
japonica GN=Os07g0607300 PE=4 SV=1
Length = 346

Score = 54.3 bits (129), Expect = 4e-06
Identities = 36/120 (30%), Positives = 59/120 (49%), Gaps = 8/120 (6%)
Frame = -1

Query: 466 VEYDELLTRDGRKKLQEIIPLNENNCQKPSTSVDPTRRGF-------IRPLPPAYCISSF 308
V+YD+L D +L+E +P+ ST P + G +RP P ++
Sbjct: 126 VQYDDLQNADDSGRLEEWVPV--------STLARPDKLGLRCPERRRVRPRPQQNSLADG 177

Query: 307 KSPKKGLLVDAFYEYAWWEGVLLH-DIITRDKDFKVKILFPEEGDELLCSIKDVRVSQEW 131
+ G VD + WWEGVL+ D I+ D ++I FP E +C +K++R+S++W
Sbjct: 178 TNLLPGAAVDVWQFSGWWEGVLVSADNISAD---SLQIYFPGENFFSVCQLKNLRISKDW 234


>tr|A2YNJ7|A2YNJ7_ORYSI Putative uncharacterized protein OS=Oryza
sativa subsp. indica GN=OsI_26810 PE=4 SV=1
Length = 636

Score = 54.3 bits (129), Expect = 4e-06
Identities = 36/120 (30%), Positives = 59/120 (49%), Gaps = 8/120 (6%)
Frame = -1

Query: 466 VEYDELLTRDGRKKLQEIIPLNENNCQKPSTSVDPTRRGF-------IRPLPPAYCISSF 308
V+YD+L D +L+E +P+ ST P + G +RP P ++
Sbjct: 416 VQYDDLQNADDSGRLEEWVPV--------STLARPDKLGLRCPERRRVRPRPQQNSLADG 467

Query: 307 KSPKKGLLVDAFYEYAWWEGVLLH-DIITRDKDFKVKILFPEEGDELLCSIKDVRVSQEW 131
+ G VD + WWEGVL+ D I+ D ++I FP E +C +K++R+S++W
Sbjct: 468 TNLLPGAAVDVWQFSGWWEGVLVSADNISAD---SLQIYFPGENFFSVCQLKNLRISKDW 524


>tr|A9RX43|A9RX43_PHYPA Predicted protein OS=Physcomitrella patens
subsp. patens GN=PHYPADRAFT_120611 PE=4 SV=1
Length = 530

Score = 53.5 bits (127), Expect = 6e-06
Identities = 35/129 (27%), Positives = 60/129 (46%)
Frame = -1

Query: 517 GSWHPGVVVQVKDGRRIVEYDELLTRDGRKKLQEIIPLNENNCQKPSTSVDPTRRGFIRP 338
G W + + R V YD+L DG L+E + + + R +RP
Sbjct: 358 GCWFKATITRRVSKRLKVRYDKLQNEDGEGNLEEWVSA-WRLAGPDKSGMRVAGRTTVRP 416

Query: 337 LPPAYCISSFKSPKKGLLVDAFYEYAWWEGVLLHDIITRDKDFKVKILFPEEGDELLCSI 158
++ +S+ + G VDA++ WWEG+ II ++ +++ FP EGD I
Sbjct: 417 FA-SFNVSAGEC-NIGQAVDAWWNDGWWEGI----IINKESSGDIQVYFPGEGDTCSFKI 470

Query: 157 KDVRVSQEW 131
+D+R S++W
Sbjct: 471 EDLRTSRDW 479