BP918335
Clone id YMU001_000112_C09
Library
Length 530
Definition Adiantum capillus-veneris mRNA. clone: YMU001_000112_C09.
Accession
Tissue type prothallium
Developmental stage -
Contig ID -
Sequence
CTTCAGAATCTTGGCTTCTTTTGCTCTCGAACCTTGAACTGCGAGCTTCATCTTCATCAC
CTTGTGGATGCTTTGACTTTTCCTCACTGAGGTTCTTTAAGCGATCTTTAATCATTTGAT
TCAATTGATCTTTTTTGAAATCCTGATTCTCTATGATAATGTCGTTCACACCCTTGATTT
CAAGCAACTGTGTCTTGGGCCTATCTTTTGTGCTTTGCGACAAGATCTGCTTCTTTTCTG
GAGATCTCGTTGGGGATTCTTGCTTCTGTTCCTTTGTTGTCACTGTCTGAACTTTGCTTT
TGGCTTGTTGCTTCTTCTTTTCCATGTAGAGCTTTGCTGGGCAGTCCTTCACTAAATGAA
CAATGGCACATTGATTACAATATGTCGCTATCTCAACATATGCACCCTTTAAATGAGGCA
GCTCTCCATAATATTGCTGATAATGGTTTCCTGTGGTATCTAGATACAGATATGACCTCT
TCTTTGCATGCATGAACCTATAGATTACTGATGACTTTGCGCAGGTACTC
■■Homology search results ■■ -
sp_hit_id P36044
Definition sp|P36044|MNN4_YEAST Protein MNN4 OS=Saccharomyces cerevisiae
Align length 122
Score (bit) 40.4
E-value 0.005
Report
BLASTX 2.2.19 [Nov-02-2008]


Reference: Altschul, Stephen F., Thomas L. Madden, Alejandro A. Schaffer,
Jinghui Zhang, Zheng Zhang, Webb Miller, and David J. Lipman (1997),
"Gapped BLAST and PSI-BLAST: a new generation of protein database search
programs", Nucleic Acids Res. 25:3389-3402.

Query= BP918335|Adiantum capillus-veneris mRNA, clone:
YMU001_000112_C09.
(530 letters)

Database: uniprot_sprot.fasta
412,525 sequences; 148,809,765 total letters

Searching..................................................done



Score E
Sequences producing significant alignments: (bits) Value

sp|P36044|MNN4_YEAST Protein MNN4 OS=Saccharomyces cerevisiae GN... 40 0.005
sp|Q6DFC2|CCD77_XENLA Coiled-coil domain-containing protein 77 O... 40 0.007
sp|Q54EC2|DDX55_DICDI Probable ATP-dependent RNA helicase ddx55 ... 40 0.009
sp|O94465|CMS1_SCHPO Protein cms1 OS=Schizosaccharomyces pombe G... 40 0.009
sp|Q55FI4|NOL5_DICDI Nucleolar protein 5 OS=Dictyostelium discoi... 39 0.020
sp|Q6CWE8|FKBP3_KLULA FK506-binding protein 3 OS=Kluyveromyces l... 39 0.020
sp|A5DXA0|NST1_LODEL Stress response protein NST1 OS=Lodderomyce... 38 0.026
sp|P19246|NFH_MOUSE Neurofilament heavy polypeptide OS=Mus muscu... 38 0.026
sp|Q54LY8|Y6915_DICDI Uncharacterized protein DDB_G0286299 OS=Di... 37 0.059
sp|P53911|EAF7_YEAST Chromatin modification-related protein EAF7... 37 0.059
sp|P31563|YCF1_OENBE Putative membrane protein ycf1 (Fragment) O... 37 0.077
sp|Q556Q3|IRLF_DICDI Probable serine/threonine-protein kinase ir... 36 0.10
sp|A3LYI0|NST1_PICST Stress response protein NST1 OS=Pichia stip... 36 0.13
sp|P36049|EBP2_YEAST rRNA-processing protein EBP2 OS=Saccharomyc... 36 0.13
sp|Q5A6Q7|EAF7_CANAL Chromatin modification-related protein EAF7... 36 0.13
sp|P46504|YLX8_CAEEL Uncharacterized protein F23F12.8 OS=Caenorh... 35 0.17
sp|O01761|UNC89_CAEEL Muscle M-line assembly protein unc-89 OS=C... 35 0.17
sp|Q58294|RFCL_METJA Replication factor C large subunit OS=Metha... 35 0.17
sp|A5DLJ8|NST1_PICGU Stress response protein NST1 OS=Pichia guil... 35 0.17
sp|Q54J55|MYBX_DICDI Myb-like protein X OS=Dictyostelium discoid... 35 0.17
sp|O96133|YB145_PLAF7 Uncharacterized protein PFB0145c OS=Plasmo... 35 0.22
sp|Q54QQ2|Y5634_DICDI Uncharacterized protein DDB_G0283697 OS=Di... 35 0.22
sp|Q8SX83|SPEN_DROME Protein split ends OS=Drosophila melanogast... 35 0.22
sp|Q9EP71|RAI14_MOUSE Ankycorbin OS=Mus musculus GN=Rai14 PE=1 SV=1 35 0.22
sp|Q5BDC8|NOP12_EMENI Nucleolar protein 12 OS=Emericella nidulan... 35 0.22
sp|A3KNA5|FIL1L_DANRE Filamin A-interacting protein 1-like OS=Da... 35 0.22
sp|Q869E1|DNLI1_DICDI DNA ligase 1 OS=Dictyostelium discoideum G... 35 0.22
sp|P15381|CAC1C_RABIT Voltage-dependent L-type calcium channel s... 35 0.22
sp|A2VDP1|BRE1A_BOVIN E3 ubiquitin-protein ligase BRE1A OS=Bos t... 35 0.22
sp|Q924R9|NP1L3_RAT Nucleosome assembly protein 1-like 3 OS=Ratt... 35 0.29

>sp|P36044|MNN4_YEAST Protein MNN4 OS=Saccharomyces cerevisiae GN=MNN4
PE=2 SV=2
Length = 1178

Score = 40.4 bits (93), Expect = 0.005
Identities = 26/122 (21%), Positives = 62/122 (50%), Gaps = 10/122 (8%)
Frame = -2

Query: 337 AKLYMEKKKQQAKSKVQTVTTKEQKQESPTRSPEKKQILSQSTKDRPKTQLLEIKGVNDI 158
AKL E+K+++ K K + K++++E + E+K+ + K + + + + K +
Sbjct: 1031 AKLLEERKRREKKKKEEEEKKKKEEEEKKKKEEEEKKKKEEEEKKKKEEEEKKKKEEEEK 1090

Query: 157 IIENQDFKK-----DQLNQMIKDRLKNLSEEKSKH-----PQGDEDEARSSRFESKRSQD 8
+ ++ KK ++ Q +++KN EE K+ + +E+E + ++K+++D
Sbjct: 1091 KKQEEEEKKKKEEEEKKKQEEGEKMKNEDEENKKNEDEEKKKNEEEEKKKQEEKNKKNED 1150

Query: 7 SE 2
E
Sbjct: 1151 EE 1152



Score = 38.9 bits (89), Expect = 0.015
Identities = 27/108 (25%), Positives = 56/108 (51%), Gaps = 1/108 (0%)
Frame = -2

Query: 322 EKKKQQAKSKVQTVTTKEQKQESPTRSPEKKQILSQSTKDRPKTQLLEIKGVNDIIIENQ 143
+KKK++ + K + K++K+E + E+++ Q +++ K + E K E +
Sbjct: 1058 KKKKEEEEKKKKEEEEKKKKEEEEKKKKEEEEKKKQEEEEKKKKEEEEKKKQE----EGE 1113

Query: 142 DFK-KDQLNQMIKDRLKNLSEEKSKHPQGDEDEARSSRFESKRSQDSE 2
K +D+ N+ +D K +EE+ K Q E++ + + E K+ Q+ E
Sbjct: 1114 KMKNEDEENKKNEDEEKKKNEEEEKKKQ--EEKNKKNEDEEKKKQEEE 1159



Score = 38.9 bits (89), Expect = 0.015
Identities = 23/105 (21%), Positives = 54/105 (51%)
Frame = -2

Query: 322 EKKKQQAKSKVQTVTTKEQKQESPTRSPEKKQILSQSTKDRPKTQLLEIKGVNDIIIENQ 143
EKKK++ + K + KE++++ EKK+ + K + + + ++ + + E++
Sbjct: 1073 EKKKKEEEEKKK----KEEEEKKKQEEEEKKKKEEEEKKKQEEGEKMKNEDEENKKNEDE 1128

Query: 142 DFKKDQLNQMIKDRLKNLSEEKSKHPQGDEDEARSSRFESKRSQD 8
+ KK++ + K KN E + + +E+E + + E K+ Q+
Sbjct: 1129 EKKKNEEEEKKKQEEKNKKNEDEEKKKQEEEEKKKNEEEEKKKQE 1173


>sp|Q6DFC2|CCD77_XENLA Coiled-coil domain-containing protein 77
OS=Xenopus laevis GN=ccdc77 PE=2 SV=1
Length = 496

Score = 40.0 bits (92), Expect = 0.007
Identities = 28/122 (22%), Positives = 62/122 (50%), Gaps = 4/122 (3%)
Frame = -2

Query: 364 IVHLVKDCPAKLYMEKKKQQAKS----KVQTVTTKEQKQESPTRSPEKKQILSQSTKDRP 197
I + K+ P+K+ + ++ Q+ KVQ KQ P ++P K+ + K+ P
Sbjct: 155 ITYFHKEPPSKVTIPQRTVQSGDPFDRKVQRSGRAGVKQV-PLKAPGKQDRTKAAEKEDP 213

Query: 196 KTQLLEIKGVNDIIIENQDFKKDQLNQMIKDRLKNLSEEKSKHPQGDEDEARSSRFESKR 17
+ LL+++ + + E K+Q+ +++DR + E + +H Q D+D+ ++ + +
Sbjct: 214 QILLLQVEALQAQLEEQTRLSKEQIETLLEDRKVRMEEAQVQH-QRDQDKMKAMTDKLNK 272

Query: 16 SQ 11
+Q
Sbjct: 273 TQ 274


>sp|Q54EC2|DDX55_DICDI Probable ATP-dependent RNA helicase ddx55
OS=Dictyostelium discoideum GN=ddx55 PE=3 SV=1
Length = 663

Score = 39.7 bits (91), Expect = 0.009
Identities = 33/118 (27%), Positives = 53/118 (44%), Gaps = 9/118 (7%)
Frame = -2

Query: 328 YMEKKKQQAK-SKVQTVTTKEQK--QESPTRSPEKKQILSQSTKDR------PKTQLLEI 176
Y EKKK++ + KV + K++K +E EKK+ L Q D+ PK +EI
Sbjct: 535 YKEKKKEKQRLEKVNKIKLKKEKDAKERQDAINEKKRKLEQQEADKLLQKQQPKQSSIEI 594

Query: 175 KGVNDIIIENQDFKKDQLNQMIKDRLKNLSEEKSKHPQGDEDEARSSRFESKRSQDSE 2
+ ++ Q+ KK Q + I + L K + + +SSRF D+E
Sbjct: 595 Q------LKKQEEKKKQEQESINEILHETQAFKKARKSKQQKKDKSSRFSDLMGSDTE 646


>sp|O94465|CMS1_SCHPO Protein cms1 OS=Schizosaccharomyces pombe
GN=cms1 PE=2 SV=1
Length = 277

Score = 39.7 bits (91), Expect = 0.009
Identities = 23/65 (35%), Positives = 34/65 (52%)
Frame = -2

Query: 277 TKEQKQESPTRSPEKKQILSQSTKDRPKTQLLEIKGVNDIIIENQDFKKDQLNQMIKDRL 98
T Q +S R KKQ Q K+R + +LLE++ N II++ D D LN IK
Sbjct: 43 TASQNNDSAKREKRKKQ--RQKQKERKRAKLLELQDTNASIIQSPDTLSDLLNNYIKSIY 100

Query: 97 KNLSE 83
+L++
Sbjct: 101 SDLTD 105


>sp|Q55FI4|NOL5_DICDI Nucleolar protein 5 OS=Dictyostelium
discoideum GN=nol5 PE=3 SV=1
Length = 638

Score = 38.5 bits (88), Expect = 0.020
Identities = 24/106 (22%), Positives = 51/106 (48%)
Frame = -2

Query: 322 EKKKQQAKSKVQTVTTKEQKQESPTRSPEKKQILSQSTKDRPKTQLLEIKGVNDIIIENQ 143
E+KK++ K +T KE+K+E + +K + + K+ K + E K + E
Sbjct: 494 EEKKEKKSKKEETPVAKEEKKEKEEKKEKKDKKEKKEEKEDKKEEKKEKKDKKEKTEETP 553

Query: 142 DFKKDQLNQMIKDRLKNLSEEKSKHPQGDEDEARSSRFESKRSQDS 5
K+++ + K++ + E+K K + ++ E + + E K + S
Sbjct: 554 VAKEEKKEK--KEKKEEKEEKKDKKEKKEKKEEKEEKKEKKEKKSS 597



Score = 38.5 bits (88), Expect = 0.020
Identities = 31/123 (25%), Positives = 58/123 (47%), Gaps = 7/123 (5%)
Frame = -2

Query: 349 KDCPAKLYMEKKKQQAKSKVQTVTTKEQKQESPTRSPEKKQILSQSTKDRP--KTQLLEI 176
++ P +K+K++ K K KE+K++ EKK + T++ P K + E
Sbjct: 504 EETPVAKEEKKEKEEKKEKKDKKEKKEEKEDKKEEKKEKKD-KKEKTEETPVAKEEKKEK 562

Query: 175 KGVNDIIIENQDFKKDQLNQMIKDRLKNLSEEKS-----KHPQGDEDEARSSRFESKRSQ 11
K + E +D K+ + + K+ K E+KS K + ++ E +SS E K+ +
Sbjct: 563 KEKKEEKEEKKDKKEKKEKKEEKEEKKEKKEKKSSSKEDKKEKEEKKEKKSSSKEDKKRK 622

Query: 10 DSE 2
D +
Sbjct: 623 DRD 625



Score = 38.1 bits (87), Expect = 0.026
Identities = 27/107 (25%), Positives = 50/107 (46%)
Frame = -2

Query: 322 EKKKQQAKSKVQTVTTKEQKQESPTRSPEKKQILSQSTKDRPKTQLLEIKGVNDIIIENQ 143
E+K+ + + K + KE+ +E+P EKK+ + + K E K + E +
Sbjct: 530 EEKEDKKEEKKEKKDKKEKTEETPVAKEEKKEKKEKKEEKEEKKDKKEKKEKKEEKEEKK 589

Query: 142 DFKKDQLNQMIKDRLKNLSEEKSKHPQGDEDEARSSRFESKRSQDSE 2
+ KK++ + +D+ K E+K K ED+ R R E + S+
Sbjct: 590 E-KKEKKSSSKEDK-KEKEEKKEKKSSSKEDKKRKDRDEEPEEKKSK 634



Score = 36.2 bits (82), Expect = 0.10
Identities = 25/104 (24%), Positives = 52/104 (50%), Gaps = 3/104 (2%)
Frame = -2

Query: 322 EKKKQQAKSKVQTVTT---KEQKQESPTRSPEKKQILSQSTKDRPKTQLLEIKGVNDIII 152
E+KK++ K +T T KE+K+E + EK++ + K K + E K +
Sbjct: 537 EEKKEKKDKKEKTEETPVAKEEKKEKKEKKEEKEEKKDKKEKKEKKEEKEEKKEKKEKKS 596

Query: 151 ENQDFKKDQLNQMIKDRLKNLSEEKSKHPQGDEDEARSSRFESK 20
+++ KK++ + K++ + E+K + + +E E + S+ K
Sbjct: 597 SSKEDKKEKEEK--KEKKSSSKEDKKRKDRDEEPEEKKSKKSKK 638



Score = 33.1 bits (74), Expect = 0.85
Identities = 25/108 (23%), Positives = 50/108 (46%), Gaps = 2/108 (1%)
Frame = -2

Query: 319 KKKQQAKSKVQTVTTKEQKQESPTRSPEKKQILSQSTKDRPKTQLLEIKGVNDIIIENQD 140
KK++ +K + K +K+E+P EKK+ + K K + E + + E +D
Sbjct: 485 KKEETPVAKEEKKEKKSKKEETPVAKEEKKEKEEKKEKKDKKEKKEEKEDKKEEKKEKKD 544

Query: 139 FK-KDQLNQMIKDRLKNLSEEK-SKHPQGDEDEARSSRFESKRSQDSE 2
K K + + K+ K E+K K + D+ E + + E + ++ +
Sbjct: 545 KKEKTEETPVAKEEKKEKKEKKEEKEEKKDKKEKKEKKEEKEEKKEKK 592


>sp|Q6CWE8|FKBP3_KLULA FK506-binding protein 3 OS=Kluyveromyces
lactis GN=FPR3 PE=3 SV=1
Length = 418

Score = 38.5 bits (88), Expect = 0.020
Identities = 24/64 (37%), Positives = 36/64 (56%)
Frame = -2

Query: 334 KLYMEKKKQQAKSKVQTVTTKEQKQESPTRSPEKKQILSQSTKDRPKTQLLEIKGVNDII 155
KL E KK + K + V K+ +E PT+ EKK + K++PKT++LE II
Sbjct: 266 KLVEETKKNKKAKKEKKVEFKKDLEEGPTKKEEKK----EEKKEKPKTKVLE----GGII 317

Query: 154 IENQ 143
IE++
Sbjct: 318 IEDR 321


>sp|A5DXA0|NST1_LODEL Stress response protein NST1 OS=Lodderomyces
elongisporus GN=NST1 PE=3 SV=1
Length = 1637

Score = 38.1 bits (87), Expect = 0.026
Identities = 27/111 (24%), Positives = 51/111 (45%)
Frame = -2

Query: 334 KLYMEKKKQQAKSKVQTVTTKEQKQESPTRSPEKKQILSQSTKDRPKTQLLEIKGVNDII 155
KL+ E+ K K KV T++ +E K++ ++ K + K + E K + +
Sbjct: 839 KLFQERLKSAYKEKVSKDNTRKLFEELEAEEAAKREKEAKKLKQKEKAK--ERKRLQQLA 896

Query: 154 IENQDFKKDQLNQMIKDRLKNLSEEKSKHPQGDEDEARSSRFESKRSQDSE 2
E + KK++ + I + L E+ + ++EAR R E K+ + E
Sbjct: 897 KEEEKRKKEEEAKRIAEELHAKQEQLKLEQKKKKEEARLRREEEKKKKLEE 947


>sp|P19246|NFH_MOUSE Neurofilament heavy polypeptide OS=Mus musculus
GN=Nefh PE=1 SV=3
Length = 1090

Score = 38.1 bits (87), Expect = 0.026
Identities = 32/117 (27%), Positives = 59/117 (50%), Gaps = 1/117 (0%)
Frame = -2

Query: 349 KDCPAKLYMEKKKQQAKSKVQTVTTKEQKQESPTRSPEKKQILSQSTKDR-PKTQLLEIK 173
++ PAKL + K++AK K +T TTK + +++ + P K + K+ P +
Sbjct: 967 EETPAKLGV---KEEAKPKEKTETTKTEAEDTKAKEPSKPTETEKPKKEEMPAAPEKKDT 1023

Query: 172 GVNDIIIENQDFKKDQLNQMIKDRLKNLSEEKSKHPQGDEDEARSSRFESKRSQDSE 2
+ +K ++ +K+ K+LS+E SK P+ ++ E +SS + K SQ E
Sbjct: 1024 KEEKTTESRKPEEKPKMEAKVKEDDKSLSKEPSK-PKTEKAE-KSSSTDQKESQPPE 1078


>sp|Q54LY8|Y6915_DICDI Uncharacterized protein DDB_G0286299
OS=Dictyostelium discoideum GN=DDB_G0286299 PE=4 SV=1
Length = 451

Score = 37.0 bits (84), Expect = 0.059
Identities = 33/126 (26%), Positives = 55/126 (43%), Gaps = 12/126 (9%)
Frame = -2

Query: 349 KDCPAKLYMEKKKQQAKSKVQTVTT------KEQKQESPTRS---PEKKQILSQSTK--D 203
K+ K + KK+ K + + TT K++K+E P + +K Q ++ K D
Sbjct: 171 KEAKPKKEAKPKKETTKKEKEATTTSSDSTEKKEKEEKPKKEKKISKKDQAAAEKKKDGD 230

Query: 202 RPKTQLLEIKGVNDIIIENQDFKKDQLNQMIKDRLKNLSEEKSK-HPQGDEDEARSSRFE 26
T D EN++ KKD+ K K + EK K GD+DE ++ E
Sbjct: 231 DSTTTTATATTTTDDSTENKEEKKDK-----KTTKKPAAAEKKKVKKDGDDDETAAAATE 285

Query: 25 SKRSQD 8
K+ ++
Sbjct: 286 EKKDEE 291



Score = 33.1 bits (74), Expect = 0.85
Identities = 22/97 (22%), Positives = 44/97 (45%)
Frame = -2

Query: 310 QQAKSKVQTVTTKEQKQESPTRSPEKKQILSQSTKDRPKTQLLEIKGVNDIIIENQDFKK 131
Q AK K+ +++K+E + P++ + + K + KT+ K +D E + K+
Sbjct: 68 QAAKRKLIDTKERKEKKEKKEKEPKEPKEPKEKAKKKAKTE----KKKDDGDEEEDEEKE 123

Query: 130 DQLNQMIKDRLKNLSEEKSKHPQGDEDEARSSRFESK 20
+ Q + + SEE + DED+ + + K
Sbjct: 124 EDEEQKEEQSQEEDSEESEEEQNSDEDKKKKKKQAKK 160


>sp|P53911|EAF7_YEAST Chromatin modification-related protein EAF7
OS=Saccharomyces cerevisiae GN=EAF7 PE=1 SV=1
Length = 425

Score = 37.0 bits (84), Expect = 0.059
Identities = 24/111 (21%), Positives = 52/111 (46%), Gaps = 4/111 (3%)
Frame = -2

Query: 322 EKKKQQAKSKVQTVTTKEQK----QESPTRSPEKKQILSQSTKDRPKTQLLEIKGVNDII 155
E++K ++ +K K Q+ +E EK++I +TKD
Sbjct: 227 EEQKMKSTNKTAAPVRKSQRLKRSKEVKFEDEEKEEIEEDNTKD---------------- 270

Query: 154 IENQDFKKDQLNQMIKDRLKNLSEEKSKHPQGDEDEARSSRFESKRSQDSE 2
E Q KK+++ + + + +EK+++ +GD++ +S+ +E+ +SE
Sbjct: 271 -EEQKEKKEEIQEPKITHNEEVDKEKNENEEGDDEREKSTSYENTNGSESE 320


tr_hit_id B0G183
Definition tr|B0G183|B0G183_DICDI Putative uncharacterized protein (Fragment) OS=Dictyostelium discoideum
Align length 114
Score (bit) 46.6
E-value 0.0008
Report
BLASTX 2.2.19 [Nov-02-2008]


Reference: Altschul, Stephen F., Thomas L. Madden, Alejandro A. Schaffer,
Jinghui Zhang, Zheng Zhang, Webb Miller, and David J. Lipman (1997),
"Gapped BLAST and PSI-BLAST: a new generation of protein database search
programs", Nucleic Acids Res. 25:3389-3402.

Query= BP918335|Adiantum capillus-veneris mRNA, clone:
YMU001_000112_C09.
(530 letters)

Database: uniprot_trembl.fasta
7,341,751 sequences; 2,391,615,440 total letters

Searching..................................................done



Score E
Sequences producing significant alignments: (bits) Value

tr|B0G183|B0G183_DICDI Putative uncharacterized protein (Fragmen... 47 8e-04
tr|B3LQQ7|B3LQQ7_YEAS1 Protein MNN4 OS=Saccharomyces cerevisiae ... 44 0.004
tr|Q2SCL7|Q2SCL7_HAHCH TolA family protein OS=Hahella chejuensis... 44 0.005
tr|A9BVN2|A9BVN2_DELAS Protein TolA OS=Delftia acidovorans (stra... 44 0.007
tr|Q23KF2|Q23KF2_TETTH Putative uncharacterized protein OS=Tetra... 43 0.009
tr|B4MSC2|B4MSC2_DROWI GK19943 OS=Drosophila willistoni GN=GK199... 42 0.015
tr|B3L8J5|B3L8J5_PLAKH Putative uncharacterized protein OS=Plasm... 42 0.015
tr|A2E5Y7|A2E5Y7_TRIVA Putative uncharacterized protein OS=Trich... 42 0.015
tr|B4JZU2|B4JZU2_DROGR Bt OS=Drosophila grimshawi GN=Dgri\bt PE=... 42 0.019
tr|A0CXY2|A0CXY2_PARTE Chromosome undetermined scaffold_30, whol... 42 0.019
tr|Q23CS2|Q23CS2_TETTH Putative uncharacterized protein OS=Tetra... 42 0.025
tr|B6M3R8|B6M3R8_BRAFL Putative uncharacterized protein OS=Branc... 42 0.025
tr|A2FH35|A2FH35_TRIVA Erythrocyte binding protein, putative OS=... 42 0.025
tr|A2E7B0|A2E7B0_TRIVA Putative uncharacterized protein OS=Trich... 42 0.025
tr|A2DCE1|A2DCE1_TRIVA Putative uncharacterized protein OS=Trich... 42 0.025
tr|Q871K9|Q871K9_NEUCR Putative uncharacterized protein 20H10.09... 42 0.025
tr|A7UX50|A7UX50_NEUCR Putative uncharacterized protein OS=Neuro... 42 0.025
tr|A2FDS6|A2FDS6_TRIVA Variable membrane protein, putative OS=Tr... 41 0.033
tr|B2UMN9|B2UMN9_AKKM8 von Willebrand factor type A OS=Akkermans... 41 0.043
tr|Q93209|Q93209_CAEEL Protein C15A11.2, partially confirmed by ... 41 0.043
tr|B0G198|B0G198_DICDI LIM domain-containing protein OS=Dictyost... 41 0.043
tr|A2DSJ7|A2DSJ7_TRIVA Putative uncharacterized protein OS=Trich... 41 0.043
tr|Q9U0P0|Q9U0P0_PLAFA Liver stage antigen-3 OS=Plasmodium falci... 40 0.056
tr|Q54CA5|Q54CA5_DICDI Putative uncharacterized protein OS=Dicty... 40 0.056
tr|B0EP65|B0EP65_ENTDI Putative uncharacterized protein OS=Entam... 40 0.056
tr|A2E3F2|A2E3F2_TRIVA Putative uncharacterized protein OS=Trich... 40 0.056
tr|A7EE50|A7EE50_SCLS1 Putative uncharacterized protein OS=Scler... 40 0.056
tr|A7A087|A7A087_YEAS7 Mannosyltransferase OS=Saccharomyces cere... 40 0.056
tr|A5DRN8|A5DRN8_LODEL SWR1-complex protein 4 OS=Lodderomyces el... 40 0.056
tr|B8JKP8|B8JKP8_DANRE Novel protein similar to vertebrate kines... 40 0.074

>tr|B0G183|B0G183_DICDI Putative uncharacterized protein (Fragment)
OS=Dictyostelium discoideum GN=DDB_0235211 PE=4 SV=1
Length = 569

Score = 46.6 bits (109), Expect = 8e-04
Identities = 36/114 (31%), Positives = 60/114 (52%), Gaps = 5/114 (4%)
Frame = -2

Query: 337 AKLYMEKKKQQAKSKVQTVTTKE-QKQESPTRSPEKKQILSQSTKDRPKTQLLEIKGVND 161
+K Y+ + Q +K K +T T E Q Q+ + EKK+ L KD+ + +IK
Sbjct: 78 SKFYLPIQSQFSKFKSETTTKIENQGQQLKEKGKEKKEQL----KDKSNKIIDDIK---- 129

Query: 160 IIIENQDFKKDQLNQMIKDRLKNLSEEKSKHPQ----GDEDEARSSRFESKRSQ 11
E +D KD+L Q +KDR + ++EK+KH +E + S++F+ K+ Q
Sbjct: 130 ---EKKDQYKDKLEQDLKDRKETFNQEKNKHLHHHNLNEEVDDLSNQFKEKKEQ 180


>tr|B3LQQ7|B3LQQ7_YEAS1 Protein MNN4 OS=Saccharomyces cerevisiae
(strain RM11-1a) GN=SCRG_03829 PE=4 SV=1
Length = 1155

Score = 44.3 bits (103), Expect = 0.004
Identities = 28/117 (23%), Positives = 62/117 (52%), Gaps = 5/117 (4%)
Frame = -2

Query: 337 AKLYMEKKKQQAKSKVQTVTTKEQKQESPTRSPEKKQILSQSTKDRPKTQLLEIKGVNDI 158
AKL E+K+++ K K + K++++E + E+K+ + K + + + + K +
Sbjct: 1031 AKLLEERKRREKKKKEEEEKKKKEEEEKKKKEEEEKKKKEEEEKKKKEEEEKKKKEEEEK 1090

Query: 157 IIENQDFKK-----DQLNQMIKDRLKNLSEEKSKHPQGDEDEARSSRFESKRSQDSE 2
+ ++ KK ++ Q +++KN EEK K Q DE++ ++ E K++++ E
Sbjct: 1091 KKQEEEEKKKKEEEEKKKQEEGEKMKNEDEEKKK--QEDEEKKKNEEEEKKKNEEEE 1145


>tr|Q2SCL7|Q2SCL7_HAHCH TolA family protein OS=Hahella chejuensis
(strain KCTC 2396) GN=HCH_04916 PE=4 SV=1
Length = 326

Score = 43.9 bits (102), Expect = 0.005
Identities = 28/104 (26%), Positives = 52/104 (50%)
Frame = -2

Query: 319 KKKQQAKSKVQTVTTKEQKQESPTRSPEKKQILSQSTKDRPKTQLLEIKGVNDIIIENQD 140
K+++QAK + + E+K+E + +KKQ + K+ K Q+ E + + ++
Sbjct: 97 KRQEQAKQEAERKAAAEKKREQEAIALKKKQEEERKKKEEEKRQVEEKRKAEEKKQAEEE 156

Query: 139 FKKDQLNQMIKDRLKNLSEEKSKHPQGDEDEARSSRFESKRSQD 8
KK + + K+ K L+E+K K + EAR E KR ++
Sbjct: 157 RKKKEAERKKKEEEKRLAEQKQKELERQMKEAR----EKKRQEE 196


>tr|A9BVN2|A9BVN2_DELAS Protein TolA OS=Delftia acidovorans (strain
DSM 14801 / SPH-1) GN=Daci_2461 PE=4 SV=1
Length = 380

Score = 43.5 bits (101), Expect = 0.007
Identities = 28/118 (23%), Positives = 65/118 (55%), Gaps = 3/118 (2%)
Frame = -2

Query: 346 DCPAKLYMEKKK---QQAKSKVQTVTTKEQKQESPTRSPEKKQILSQSTKDRPKTQLLEI 176
D A++ +EKK+ QQ K + + +++++E R ++K ++ KD+ + + E
Sbjct: 105 DHEAEIALEKKRKIEQQKKERAEQAAREQREKERQERLDKEKA--DKAAKDKAEREKAE- 161

Query: 175 KGVNDIIIENQDFKKDQLNQMIKDRLKNLSEEKSKHPQGDEDEARSSRFESKRSQDSE 2
K D + + KKD+ Q KDRL+ ++K++ + D+++A + E ++++ ++
Sbjct: 162 KAEKDRRDKLEQQKKDKAEQDRKDRLEQQKKDKAEKEKADKEKAARDKAEREKAEKAD 219


>tr|Q23KF2|Q23KF2_TETTH Putative uncharacterized protein
OS=Tetrahymena thermophila SB210 GN=TTHERM_00193830 PE=4
SV=1
Length = 1325

Score = 43.1 bits (100), Expect = 0.009
Identities = 31/116 (26%), Positives = 58/116 (50%), Gaps = 21/116 (18%)
Frame = -2

Query: 355 LVKDCPAKL-YMEKKKQQAKSKVQTVTTKEQKQE---------------SPTRSPEKKQI 224
++K C K+ Y+ K+ Q++K K+Q + K KQE S + E +++
Sbjct: 350 ILKGCEQKIKYLNKQLQESKKKIQDLNNKLNKQEKDKEINSILDPNQYISDKQQEEIQKL 409

Query: 223 LSQSTKDRP-----KTQLLEIKGVNDIIIENQDFKKDQLNQMIKDRLKNLSEEKSK 71
L S D+ K QL + K N+++ + K++ + +++K +L LSEE S+
Sbjct: 410 LQDSMNDKEILENMKQQLKKCKQENEMLEQRDRMKQEDMQKLLK-QLMELSEENSQ 464


>tr|B4MSC2|B4MSC2_DROWI GK19943 OS=Drosophila willistoni GN=GK19943
PE=4 SV=1
Length = 906

Score = 42.4 bits (98), Expect = 0.015
Identities = 28/112 (25%), Positives = 58/112 (51%), Gaps = 9/112 (8%)
Frame = -2

Query: 322 EKKKQQAKSKVQTVTTKEQKQESPTRSPEKKQILSQSTKDRPKTQLLEIKGVNDIIIENQ 143
+ +++ K +++ TKE K+ + PEK Q + K++P+ +L++ ND + +++
Sbjct: 501 DNNEEEEKEAGESLDTKESKRMEDEKEPEKAQ--ENTEKEKPEKELIKEINENDTLKDDE 558

Query: 142 DFKKDQLNQMIK---------DRLKNLSEEKSKHPQGDEDEARSSRFESKRS 14
K+ +L ++IK D K L+EE+S+ + E SS E + +
Sbjct: 559 QIKR-ELEELIKEQKQTKKEQDEKKELTEEQSEDTKDKEILHSSSSSEKEET 609


>tr|B3L8J5|B3L8J5_PLAKH Putative uncharacterized protein
OS=Plasmodium knowlesi (strain H) GN=PKH_121410 PE=4
SV=1
Length = 1583

Score = 42.4 bits (98), Expect = 0.015
Identities = 29/110 (26%), Positives = 57/110 (51%), Gaps = 3/110 (2%)
Frame = -2

Query: 322 EKKKQQAKSKVQTVTTKEQKQESPTRSPEKKQILSQSTKDRPKTQLLEIKGVNDIIIEN- 146
++KK++ K + + V E+K+ + EKK+I + K+ K + EIK I+N
Sbjct: 586 DEKKEEKKDEKKEVKKDEKKE---VKKDEKKEIKNDEKKEVKKDEKKEIKKDEKKEIKND 642

Query: 145 --QDFKKDQLNQMIKDRLKNLSEEKSKHPQGDEDEARSSRFESKRSQDSE 2
++ KKD+ ++ KD K + ++ K + +DE + + E K+ + E
Sbjct: 643 EKKEVKKDEKKEVKKDEKKEIKNDEKKEVK--KDEKKEVKKEVKKDEKKE 690



Score = 41.2 bits (95), Expect = 0.033
Identities = 29/120 (24%), Positives = 59/120 (49%), Gaps = 3/120 (2%)
Frame = -2

Query: 352 VKDCPAKLYMEKKKQQAKSKVQTVTTKEQKQESPTRSPEKKQILSQSTKDRPKTQLLEIK 173
VK K + +K++ K+ + K++K+E + EKK+I + K+ + E+K
Sbjct: 771 VKKDEKKEIKKDEKKEIKNDEKKEVKKDEKKE--IKKDEKKEIKNDEKKEIKNDEKKEVK 828

Query: 172 GVNDIII---ENQDFKKDQLNQMIKDRLKNLSEEKSKHPQGDEDEARSSRFESKRSQDSE 2
+ E ++ KKD+ ++ D K + +E+ K Q +E++ + + E K+ Q E
Sbjct: 829 NDEKKEVKKDEKKEVKKDEKKEIKNDEKKEVKKEEKKEGQ-NEEKKKGKKEEKKKGQKEE 887



Score = 40.8 bits (94), Expect = 0.043
Identities = 30/121 (24%), Positives = 60/121 (49%), Gaps = 9/121 (7%)
Frame = -2

Query: 352 VKDCPAKLYMEKKKQQAKSKVQTVTTKEQKQESPTRSPEKKQILSQSTKDRPKTQLLEIK 173
VK+ K + +K++ K+ + K++K+E + EKK+I + K+ K + E+K
Sbjct: 699 VKNDEKKEIKKDEKKEIKNDEKKEVKKDEKKE--VKKDEKKEIKNDEKKEVKKDEKKEVK 756

Query: 172 GVNDIIIEN---QDFKKDQLNQMIKDRLKNLSEEKSKHPQGDE------DEARSSRFESK 20
I+N ++ KKD+ ++ KD K + ++ K + DE DE + + + K
Sbjct: 757 KDEKKEIKNDEKKEVKKDEKKEIKKDEKKEIKNDEKKEVKKDEKKEIKKDEKKEIKNDEK 816

Query: 19 R 17
+
Sbjct: 817 K 817



Score = 40.8 bits (94), Expect = 0.043
Identities = 31/121 (25%), Positives = 59/121 (48%), Gaps = 9/121 (7%)
Frame = -2

Query: 352 VKDCPAKLYMEKKKQQAKSKVQTVTTKEQKQESPTRSPEKKQILSQSTKDRPKTQLLEIK 173
VK K + +K++ K+ + K++K+E + EKK+I + K+ K + EIK
Sbjct: 723 VKKDEKKEVKKDEKKEIKNDEKKEVKKDEKKE--VKKDEKKEIKNDEKKEVKKDEKKEIK 780

Query: 172 GVNDIIIEN---QDFKKDQLNQMIKDRLKNLSEEKSKHPQGDE------DEARSSRFESK 20
I+N ++ KKD+ ++ KD K + ++ K + DE DE + + + K
Sbjct: 781 KDEKKEIKNDEKKEVKKDEKKEIKKDEKKEIKNDEKKEIKNDEKKEVKNDEKKEVKKDEK 840

Query: 19 R 17
+
Sbjct: 841 K 841



Score = 38.1 bits (87), Expect = 0.28
Identities = 32/113 (28%), Positives = 54/113 (47%), Gaps = 11/113 (9%)
Frame = -2

Query: 322 EKK--KQQAKSKVQTVTTKEQKQESPTRSPEKKQILSQSTKDRPKTQLLEIKGVNDIIIE 149
EKK K K +V+ KE K+E + EKK+I + K+ + EIK I+
Sbjct: 659 EKKEIKNDEKKEVKKDEKKEVKKE--VKKDEKKEIKNDEKKEVKNDEKKEIKKDEKKEIK 716

Query: 148 N---QDFKKDQLNQMIKDRLKNLSEEKSKHPQGDE------DEARSSRFESKR 17
N ++ KKD+ ++ KD K + ++ K + DE DE + + + K+
Sbjct: 717 NDEKKEVKKDEKKEVKKDEKKEIKNDEKKEVKKDEKKEVKKDEKKEIKNDEKK 769



Score = 37.7 bits (86), Expect = 0.37
Identities = 30/118 (25%), Positives = 58/118 (49%), Gaps = 7/118 (5%)
Frame = -2

Query: 349 KDCPAKLYMEKKKQQAKSKVQTVTTKEQKQESPTRSPEKKQILSQSTKDRPKTQLLEIKG 170
KD ++ ++KK+ K + + + E+K+ ++ EKK++ K+ K + EIK
Sbjct: 609 KDEKKEIKNDEKKEVKKDEKKEIKKDEKKE---IKNDEKKEVKKDEKKEVKKDEKKEIK- 664

Query: 169 VNDIIIE-NQDFKKDQLNQMIKDRLKNLSEEKSKHPQGDE------DEARSSRFESKR 17
ND E +D KK+ ++ KD K + ++ K + DE DE + + + K+
Sbjct: 665 -NDEKKEVKKDEKKEVKKEVKKDEKKEIKNDEKKEVKNDEKKEIKKDEKKEIKNDEKK 721



Score = 34.7 bits (78), Expect = 3.1
Identities = 26/116 (22%), Positives = 56/116 (48%)
Frame = -2

Query: 349 KDCPAKLYMEKKKQQAKSKVQTVTTKEQKQESPTRSPEKKQILSQSTKDRPKTQLLEIKG 170
KD ++ ++KK+ + + + E+K+ ++ EKK++ K+ K + EIK
Sbjct: 797 KDEKKEIKKDEKKEIKNDEKKEIKNDEKKE---VKNDEKKEVKKDEKKEVKKDEKKEIK- 852

Query: 169 VNDIIIENQDFKKDQLNQMIKDRLKNLSEEKSKHPQGDEDEARSSRFESKRSQDSE 2
ND E ++ KK++ + + K +E+ K Q E++ + + + K+ E
Sbjct: 853 -ND---EKKEVKKEEKKEGQNEEKKKGKKEEKKKGQ-KEEKKKGKKVQEKKDHKKE 903


>tr|A2E5Y7|A2E5Y7_TRIVA Putative uncharacterized protein
OS=Trichomonas vaginalis G3 GN=TVAG_399490 PE=4 SV=1
Length = 4873

Score = 42.4 bits (98), Expect = 0.015
Identities = 30/119 (25%), Positives = 56/119 (47%), Gaps = 3/119 (2%)
Frame = -2

Query: 349 KDCPAKLYMEKKKQQAKSKVQTVTTKEQKQESPT--RSPEKKQILSQSTKDRPKTQLLEI 176
KD K + KK + K K + KE+K + P + EKK + K + K + +
Sbjct: 1016 KDKDKKEKKKDKKDKNKDKEEKEDKKEKKDKEPKDENTEEKKDKKEKKEKKKDKKEKKKD 1075

Query: 175 KGVNDIII-ENQDFKKDQLNQMIKDRLKNLSEEKSKHPQGDEDEARSSRFESKRSQDSE 2
K + + E ++ K D+ + KD+ K+ E+K K + D+D+ + + + K + E
Sbjct: 1076 KDDEEKVEKEEKELKNDEKVEEKKDKKKDKKEKKDKKSKEDKDDKKEKKKDKKDKKPKE 1134



Score = 38.5 bits (88), Expect = 0.21
Identities = 26/118 (22%), Positives = 58/118 (49%), Gaps = 7/118 (5%)
Frame = -2

Query: 337 AKLYMEKKKQQAKSKVQTVTTKEQKQESPTRSPEKKQ--ILSQSTKDRPKTQLLEIKGVN 164
A + E+KK+ K + + T +++K+E+P EK + + + KD K E +
Sbjct: 4444 APIEEEEKKESQKEEEKAPTEEKEKKETPKEEEEKPEAVVTPEPQKDEEKIP-TEEEEKK 4502

Query: 163 DIIIENQDFKKDQLNQMIKDRLKNL-----SEEKSKHPQGDEDEARSSRFESKRSQDS 5
++I+ ++ K+ +L ++ K EEK + P+ +E+E + E + +++
Sbjct: 4503 EVIVTSEPPKEKELKVEEEEEKKETPKAEEEEEKKETPKAEEEEEKKEPQEEEEKKET 4560



Score = 37.7 bits (86), Expect = 0.37
Identities = 32/130 (24%), Positives = 59/130 (45%), Gaps = 14/130 (10%)
Frame = -2

Query: 349 KDCPAKLYMEKKKQQAKSKVQTVTTKEQKQESPTRSPEKKQILSQSTKDRPKTQLL---- 182
KD K +K+K+Q K K KE+ ++ + P++ + KD KT ++
Sbjct: 1380 KDSKEKKEDKKEKKQKKDK-----KKEESEDKDIKEPKENAKEEKQEKDSSKTNIVFPII 1434

Query: 181 ----EIKGVNDIII------ENQDFKKDQLNQMIKDRLKNLSEEKSKHPQGDEDEARSSR 32
E+ D+ + E ++ K+QL + I + KN EEK + +E+++
Sbjct: 1435 ATKEELTAEKDLQLNENLSSETKESPKEQLPEEIPESSKN-EEEKQSPSEKEEEKSPEIP 1493

Query: 31 FESKRSQDSE 2
E K ++ SE
Sbjct: 1494 AEDKENRPSE 1503



Score = 36.2 bits (82), Expect = 1.1
Identities = 32/120 (26%), Positives = 55/120 (45%), Gaps = 4/120 (3%)
Frame = -2

Query: 349 KDCPAKLYMEKK----KQQAKSKVQTVTTKEQKQESPTRSPEKKQILSQSTKDRPKTQLL 182
K+ PAK EKK K++ + K + V +E+K+E P + E+K + + P
Sbjct: 3813 KEEPAKEEEEKKEEPVKEEEEKKEEPVKEEEEKKEEPVKEEEEK----KDGEVIPNESNE 3868

Query: 181 EIKGVNDIIIENQDFKKDQLNQMIKDRLKNLSEEKSKHPQGDEDEARSSRFESKRSQDSE 2
EIK + E QD K+ EE+ K +E+E + S E++++ +E
Sbjct: 3869 EIKDEEHLKEEKQDPKE---------------EEEVKEKTNEEEEVKDSTQETQQTLPNE 3913



Score = 34.7 bits (78), Expect = 3.1
Identities = 30/107 (28%), Positives = 47/107 (43%), Gaps = 2/107 (1%)
Frame = -2

Query: 322 EKKKQQAK-SKVQTVTTKEQKQESPTRSPEKKQILSQSTKDRPKTQLLEIKGVNDIIIEN 146
+KKK+ K K + V KE K E KK++ T D+ EN
Sbjct: 1208 KKKKKDKKEKKSKDVDNKEDKIEK-QEGDSKKEVKDDETNDK----------------EN 1250

Query: 145 QDFKKDQLNQMIKDRLKNL-SEEKSKHPQGDEDEARSSRFESKRSQD 8
++ KKD+ ++ K + L +EK K + DE +A E+K Q+
Sbjct: 1251 KEKKKDKKSKKSKAEEEKLDKKEKKKDQKSDEKKAEKDNSENKIEQE 1297



Score = 34.7 bits (78), Expect = 3.1
Identities = 28/128 (21%), Positives = 59/128 (46%), Gaps = 12/128 (9%)
Frame = -2

Query: 349 KDCPAKLYMEKKKQQAKSKVQTVTTKEQKQESPT---RSPEKKQI-LSQSTKDRPKTQLL 182
K+ P + EKK+ + K+ + +++K+E +KK+I + + K T +
Sbjct: 4127 KEIPKEEEEEKKENEKKAAAVVIIPEQRKEEEKNLHQEEEDKKEIPVEEEEKQEVVTSVP 4186

Query: 181 EIKGVNDIIIENQDFKKD-QLNQMIKDRLKNLSEEKSKHPQGDEDEARS-------SRFE 26
+ K E ++ K+D + K+ + N EEK + P+ +E++ + + E
Sbjct: 4187 QTKDKKQAPTEEKEKKEDLPKEEEEKNEIPNEEEEKKEVPKEEEEDNKQEPNTPEPEKDE 4246

Query: 25 SKRSQDSE 2
K +Q+ E
Sbjct: 4247 KKDTQEEE 4254



Score = 34.3 bits (77), Expect = 4.0
Identities = 26/109 (23%), Positives = 48/109 (44%), Gaps = 2/109 (1%)
Frame = -2

Query: 322 EKKKQQAKSKVQTVTTKEQKQES--PTRSPEKKQILSQSTKDRPKTQLLEIKGVNDIIIE 149
E+ K + + K + T KE+K+E+ P R E K+ + + +T E + E
Sbjct: 4387 EQLKAEEEEKKEIPTEKEEKKEAIIPNRKEENKETPKEEEEKLEETATTEPQKEE----E 4442

Query: 148 NQDFKKDQLNQMIKDRLKNLSEEKSKHPQGDEDEARSSRFESKRSQDSE 2
N ++++ + K+ K +EEK K E+E + + Q E
Sbjct: 4443 NAPIEEEEKKESQKEEEKAPTEEKEKKETPKEEEEKPEAVVTPEPQKDE 4491



Score = 33.5 bits (75), Expect = 6.9
Identities = 24/113 (21%), Positives = 53/113 (46%), Gaps = 9/113 (7%)
Frame = -2

Query: 322 EKKKQQAKSKVQTVTTKEQKQESPTRSPEKKQILSQSTKDRPKTQLLEIKGVNDIIIENQ 143
+KK ++ K K + K +K+E ++ EK + KD+ + + + K D E +
Sbjct: 1065 KKKDKKEKKKDKDDEEKVEKEEKELKNDEKVEEKKDKKKDKKEKKDKKSKEDKDDKKEKK 1124

Query: 142 DFKKDQL---------NQMIKDRLKNLSEEKSKHPQGDEDEARSSRFESKRSQ 11
KKD+ N+ I+D + + +++ K+P +++ + E K+ +
Sbjct: 1125 KDKKDKKPKEEKIDNENKDIQDLSQPVEDKELKNPDNEKEAGDKEKKEKKKEE 1177



Score = 33.5 bits (75), Expect = 6.9
Identities = 24/110 (21%), Positives = 49/110 (44%), Gaps = 5/110 (4%)
Frame = -2

Query: 322 EKKKQQAKSKVQTVTTKEQKQESPTRSPEKKQILSQSTKDRPKTQLLEIKGVNDIIIENQ 143
E +Q ++ K+E + ++++ Q ++ P+ + K N I EN
Sbjct: 2798 EVNEQDKAFNIEENNEATPKEEEKPDNKHREEVNHQENENHPEEPDQQDKAFN--IEENN 2855

Query: 142 -----DFKKDQLNQMIKDRLKNLSEEKSKHPQGDEDEARSSRFESKRSQD 8
D ++ NQ ++N+S+E + P+G +DE++ S +QD
Sbjct: 2856 EATPNDLAPEEENQQESKEIQNISQENEEQPEG-KDESKKSEETKADNQD 2904



Score = 33.1 bits (74), Expect = 9.0
Identities = 24/111 (21%), Positives = 49/111 (44%)
Frame = -2

Query: 334 KLYMEKKKQQAKSKVQTVTTKEQKQESPTRSPEKKQILSQSTKDRPKTQLLEIKGVNDII 155
K+ E+KK+ + +E+K+E E+++ ++ K+ PK + +E + +
Sbjct: 4025 KVVEEEKKEAEIIPAVSPKEEEEKKEQAKHEEEEEKKETEPLKEEPKQENMEEEEKKEEE 4084

Query: 154 IENQDFKKDQLNQMIKDRLKNLSEEKSKHPQGDEDEARSSRFESKRSQDSE 2
Q ++ + Q +++ EE+ K EDEA+ E K E
Sbjct: 4085 KNTQPIEETPMQQ--ENQQNTSKEEEEKQELQKEDEAQKEEEEKKEIPKEE 4133


>tr|B4JZU2|B4JZU2_DROGR Bt OS=Drosophila grimshawi GN=Dgri\bt PE=4
SV=1
Length = 8844

Score = 42.0 bits (97), Expect = 0.019
Identities = 28/119 (23%), Positives = 59/119 (49%)
Frame = -2

Query: 358 HLVKDCPAKLYMEKKKQQAKSKVQTVTTKEQKQESPTRSPEKKQILSQSTKDRPKTQLLE 179
+L K+ K EK KQ+ + + T +E+K++ + + + + K + + ++ E
Sbjct: 713 NLKKEQKLKQEEEKLKQEEEKLKEEETIREEKKKEEEKKKQDENKKKEEAKKKEEKKMEE 772

Query: 178 IKGVNDIIIENQDFKKDQLNQMIKDRLKNLSEEKSKHPQGDEDEARSSRFESKRSQDSE 2
+K D +N++ KK + + K+ K EEK K + ++EAR E K+ ++ +
Sbjct: 773 VKIQKDEAKKNEEEKKQE--EKKKEEAKKKEEEK-KQEEKKKEEARKKEEEKKQEENKK 828


>tr|A0CXY2|A0CXY2_PARTE Chromosome undetermined scaffold_30, whole
genome shotgun sequence OS=Paramecium tetraurelia
GN=GSPATT00011281001 PE=4 SV=1
Length = 729

Score = 42.0 bits (97), Expect = 0.019
Identities = 36/135 (26%), Positives = 65/135 (48%), Gaps = 5/135 (3%)
Frame = -2

Query: 391 IATYCNQCAIVHLVKDCPAKLYMEKKKQQAKSKVQTVTTKEQKQESPTRSPEKKQILSQS 212
I+ Y Q A + K+ K +EK K++ + +++ + E K + EKK + +
Sbjct: 104 ISKYSQQDASSLIEKE---KQQIEKIKKKQQKEIENMLEFELKLQEIKEQNEKK-MQDER 159

Query: 211 TKDRPKTQLLEIKGVNDIIIENQ-----DFKKDQLNQMIKDRLKNLSEEKSKHPQGDEDE 47
TK + + LE K I+ Q KK+Q Q +KDR+K L ++ + + +E +
Sbjct: 160 TKQKQRELELEKKRAQQEEIKKQKELQKQQKKEQEEQALKDRMKLLESKEQERIKQEELK 219

Query: 46 ARSSRFESKRSQDSE 2
R E+KR +D +
Sbjct: 220 QRLREEETKRKEDEK 234