BP918356
Clone id YMU001_000112_E08
Library
Length 566
Definition Adiantum capillus-veneris mRNA. clone: YMU001_000112_E08.
Accession
Tissue type prothallium
Developmental stage -
Contig ID
Sequence
GGCTGCAGATCTGTTACTGCTAAGGGCTTTTGGAGTCCTGCTTCTCCTGCTCTTCTGCCC
CTGCACGAGTGCAACAGACGAAGCCTTCCTGGTGGTGCACAAACGCGCTTCCATCTCAAA
GCTCAAGTCCGTAGAGCATGTCACCGTCTCCATCAGCCTCCATAACGTGGGCTTCAGCAC
TGCGTATGATGTGAGTTTGAATGACGACACCTGGCCTAGTGAAAAGTTTAACCTGGTTAA
TGGAAACGCTTCCAACTCATGGGACAAGCTAGAAGCGGGAAAGTCTGTGGTTCATGTTTT
TGTTCTGGAGTCAAGGGAAAAAGGTCTCTTCTATGGAGCCCCTGCTGTTGTTAGATACAG
GATCACCGGAAAATCTGCACTGCAGGAAGCATTTTCCACCCCGATCCACGAATTGGACTT
ACTTGCAGAGAAGTCCTCAGAACAGAAGTTTCTATGGCTGAAGGATTTTGCCGTTAAGTA
TGGACCTCTTGTGTCTGTCCTATCTGCTATAAGTCTCTTTACTTATTTGTTAATCACACC
TACAAAGTCTAAGGCGGCAAAAGCTA
■■Homology search results ■■ -
sp_hit_id Q5E9E4
Definition sp|Q5E9E4|SSRB_BOVIN Translocon-associated protein subunit beta OS=Bos taurus
Align length 129
Score (bit) 62.0
E-value 2.0e-09
Report
BLASTX 2.2.19 [Nov-02-2008]


Reference: Altschul, Stephen F., Thomas L. Madden, Alejandro A. Schaffer,
Jinghui Zhang, Zheng Zhang, Webb Miller, and David J. Lipman (1997),
"Gapped BLAST and PSI-BLAST: a new generation of protein database search
programs", Nucleic Acids Res. 25:3389-3402.

Query= BP918356|Adiantum capillus-veneris mRNA, clone:
YMU001_000112_E08.
(566 letters)

Database: uniprot_sprot.fasta
412,525 sequences; 148,809,765 total letters

Searching..................................................done



Score E
Sequences producing significant alignments: (bits) Value

sp|Q5E9E4|SSRB_BOVIN Translocon-associated protein subunit beta ... 62 2e-09
sp|P23438|SSRB_CANFA Translocon-associated protein subunit beta ... 62 3e-09
sp|P43308|SSRB_HUMAN Translocon-associated protein subunit beta ... 59 2e-08
sp|Q9CPW5|SSRB_MOUSE Translocon-associated protein subunit beta ... 58 3e-08
sp|Q54VI6|SSRB_DICDI Translocon-associated protein subunit beta ... 45 3e-04
sp|Q1B6R7|AMPA_MYCSS Probable cytosol aminopeptidase OS=Mycobact... 34 0.44
sp|A1UIA8|AMPA_MYCSK Probable cytosol aminopeptidase OS=Mycobact... 34 0.44
sp|A3Q1S2|AMPA_MYCSJ Probable cytosol aminopeptidase OS=Mycobact... 34 0.44
sp|O43059|YGT6_SCHPO FCH domain-containing protein C4C3.06 OS=Sc... 33 0.98
sp|Q0SQH3|RPOA_CLOPS DNA-directed RNA polymerase subunit alpha O... 30 6.4
sp|P0C2E6|RPOA_CLOPE DNA-directed RNA polymerase subunit alpha O... 30 6.4
sp|Q0TMS5|RPOA_CLOP1 DNA-directed RNA polymerase subunit alpha O... 30 6.4
sp|Q60417|SCRB1_CRIGR Scavenger receptor class B member 1 OS=Cri... 30 8.3
sp|Q9CH00|RNR1_LACLA Ribonuclease R 1 OS=Lactococcus lactis subs... 30 8.3

>sp|Q5E9E4|SSRB_BOVIN Translocon-associated protein subunit beta
OS=Bos taurus GN=SSR2 PE=2 SV=1
Length = 183

Score = 62.0 bits (149), Expect = 2e-09
Identities = 36/129 (27%), Positives = 63/129 (48%)
Frame = +2

Query: 65 TSATDEAFLVVHKRASISKLKSVEHVTVSISLHNVGFSTAYDVSLNDDTWPSEKFNLVNG 244
T A + A L+ K +T+ +++NVG S A DV L+DD++P E F +V+G
Sbjct: 15 TQAEEGARLLASKSLLNRYAVEGRDLTLQYNIYNVGSSAALDVELSDDSFPPEDFGIVSG 74

Query: 245 NASNSWDKLEAGKSVVHVFVLESREKGLFYGAPAVVRYRITGKSALQEAFSTPIHELDLL 424
+ WD++ +V H VL + G F A V Y + F++ + +L
Sbjct: 75 MLNVKWDRIAPASNVSHTVVLRPLKAGYFNFTSATVTYLAQEDGPVVIGFTSAPGQGGIL 134

Query: 425 AEKSSEQKF 451
A++ +++F
Sbjct: 135 AQREFDRRF 143


>sp|P23438|SSRB_CANFA Translocon-associated protein subunit beta
OS=Canis familiaris GN=SSR2 PE=1 SV=1
Length = 183

Score = 61.6 bits (148), Expect = 3e-09
Identities = 31/104 (29%), Positives = 56/104 (53%)
Frame = +2

Query: 140 VTVSISLHNVGFSTAYDVSLNDDTWPSEKFNLVNGNASNSWDKLEAGKSVVHVFVLESRE 319
+T+ +++NVG S A DV L+DD++P E F +V+G + WD++ +V H VL +
Sbjct: 40 LTLQYNIYNVGSSAALDVELSDDSFPPEDFGIVSGMLNVKWDRIAPASNVSHTVVLRPLK 99

Query: 320 KGLFYGAPAVVRYRITGKSALQEAFSTPIHELDLLAEKSSEQKF 451
G F A V Y + F++ + +LA++ +++F
Sbjct: 100 AGYFNFTSATVTYLAQEDGPVVIGFTSAPGQGGILAQREFDRRF 143


>sp|P43308|SSRB_HUMAN Translocon-associated protein subunit beta
OS=Homo sapiens GN=SSR2 PE=1 SV=1
Length = 183

Score = 58.5 bits (140), Expect = 2e-08
Identities = 34/129 (26%), Positives = 62/129 (48%)
Frame = +2

Query: 65 TSATDEAFLVVHKRASISKLKSVEHVTVSISLHNVGFSTAYDVSLNDDTWPSEKFNLVNG 244
T A + A L+ K +T+ +++NVG S A DV L+DD++P E F +V+G
Sbjct: 15 TQAEEGARLLASKSLLNRYAVEGRDLTLQYNIYNVGSSAALDVELSDDSFPPEDFGIVSG 74

Query: 245 NASNSWDKLEAGKSVVHVFVLESREKGLFYGAPAVVRYRITGKSALQEAFSTPIHELDLL 424
+ WD++ +V H VL + G F A + Y + ++ + +L
Sbjct: 75 MLNVKWDRIAPASNVSHTVVLRPLKAGYFNFTSATITYLAQEDGPVVIGSTSAPGQGGIL 134

Query: 425 AEKSSEQKF 451
A++ +++F
Sbjct: 135 AQREFDRRF 143


>sp|Q9CPW5|SSRB_MOUSE Translocon-associated protein subunit beta
OS=Mus musculus GN=Ssr2 PE=1 SV=1
Length = 183

Score = 58.2 bits (139), Expect = 3e-08
Identities = 29/104 (27%), Positives = 55/104 (52%)
Frame = +2

Query: 140 VTVSISLHNVGFSTAYDVSLNDDTWPSEKFNLVNGNASNSWDKLEAGKSVVHVFVLESRE 319
+T+ +++NVG S A DV L+DD++P E F +V+G + WD++ +V H VL +
Sbjct: 40 LTLQYNIYNVGSSAALDVELSDDSFPPEDFGIVSGMLNVKWDRIAPASNVSHTVVLRPLK 99

Query: 320 KGLFYGAPAVVRYRITGKSALQEAFSTPIHELDLLAEKSSEQKF 451
G F A + Y + ++ + +LA++ +++F
Sbjct: 100 AGYFNFTSATITYLAQEDGPVVIGSTSAPGQGGILAQREFDRRF 143


>sp|Q54VI6|SSRB_DICDI Translocon-associated protein subunit beta
OS=Dictyostelium discoideum GN=ssr2 PE=2 SV=2
Length = 184

Score = 44.7 bits (104), Expect = 3e-04
Identities = 25/99 (25%), Positives = 48/99 (48%)
Frame = +2

Query: 83 AFLVVHKRASISKLKSVEHVTVSISLHNVGFSTAYDVSLNDDTWPSEKFNLVNGNASNSW 262
A L+ HK+ + E + + ++NVG AYD+S D+ + + +F V+G++ W
Sbjct: 24 AELLFHKKIVEGPVVGKE-LPIQFIIYNVGSEPAYDISFIDNDFSNAEFEFVSGSSEGKW 82

Query: 263 DKLEAGKSVVHVFVLESREKGLFYGAPAVVRYRITGKSA 379
+ L V + ++ G++ V+ YR T S+
Sbjct: 83 ETLAPNSQVQTNLTVIPKKSGIYSLTSTVLNYRKTQTSS 121


>sp|Q1B6R7|AMPA_MYCSS Probable cytosol aminopeptidase
OS=Mycobacterium sp. (strain MCS) GN=pepA PE=3 SV=1
Length = 513

Score = 34.3 bits (77), Expect = 0.44
Identities = 17/52 (32%), Positives = 27/52 (51%)
Frame = +2

Query: 206 DTWPSEKFNLVNGNASNSWDKLEAGKSVVHVFVLESREKGLFYGAPAVVRYR 361
D WP++ V GNA+ S DK+ A + + LE+ +GL G+ +R
Sbjct: 95 DEWPADTVRRVAGNAARSLDKVAAVLTTLSALDLEAAIEGLILGSYRFTEFR 146


>sp|A1UIA8|AMPA_MYCSK Probable cytosol aminopeptidase
OS=Mycobacterium sp. (strain KMS) GN=pepA PE=3 SV=1
Length = 513

Score = 34.3 bits (77), Expect = 0.44
Identities = 17/52 (32%), Positives = 27/52 (51%)
Frame = +2

Query: 206 DTWPSEKFNLVNGNASNSWDKLEAGKSVVHVFVLESREKGLFYGAPAVVRYR 361
D WP++ V GNA+ S DK+ A + + LE+ +GL G+ +R
Sbjct: 95 DEWPADTVRRVAGNAARSLDKVAAVLTTLSALDLEAAIEGLILGSYRFTEFR 146


>sp|A3Q1S2|AMPA_MYCSJ Probable cytosol aminopeptidase
OS=Mycobacterium sp. (strain JLS) GN=pepA PE=3 SV=1
Length = 513

Score = 34.3 bits (77), Expect = 0.44
Identities = 17/52 (32%), Positives = 27/52 (51%)
Frame = +2

Query: 206 DTWPSEKFNLVNGNASNSWDKLEAGKSVVHVFVLESREKGLFYGAPAVVRYR 361
D WP++ V GNA+ S DK+ A + + LE+ +GL G+ +R
Sbjct: 95 DEWPADTVRRVAGNAARSLDKVAAVLTTLSALDLEAAIEGLILGSYRFTEFR 146


>sp|O43059|YGT6_SCHPO FCH domain-containing protein C4C3.06
OS=Schizosaccharomyces pombe GN=SPBC4C3.06 PE=1 SV=1
Length = 818

Score = 33.1 bits (74), Expect = 0.98
Identities = 20/52 (38%), Positives = 26/52 (50%)
Frame = +2

Query: 392 FSTPIHELDLLAEKSSEQKFLWLKDFAVKYGPLVSVLSAISLFTYLLITPTK 547
F+TP E+ + F L D AVKYGP + L SL LL++P K
Sbjct: 588 FNTPPPEMGVRVASEFPMSFTHLNDHAVKYGPSENTL---SLIPELLLSPIK 636


>sp|Q0SQH3|RPOA_CLOPS DNA-directed RNA polymerase subunit alpha
OS=Clostridium perfringens (strain SM101 / Type A)
GN=rpoA PE=3 SV=1
Length = 315

Score = 30.4 bits (67), Expect = 6.4
Identities = 18/70 (25%), Positives = 34/70 (48%), Gaps = 5/70 (7%)
Frame = -3

Query: 309 SRTKT*TTDFPASSLSHELEAFPLTRLNFSLGQVSSFKLTSYAVLKPTLW-----RLMET 145
++ K T D P S+++ + P+ R+NFS+ ++T Y L +W R+ E
Sbjct: 150 TQNKNKTEDLPLSAIAIDSIYTPVKRVNFSVQNTRVGQITDYDKLTLEIWTNGTIRIEEA 209

Query: 144 VTCSTDLSFE 115
++ S + E
Sbjct: 210 ISLSAKILIE 219


tr_hit_id A9P297
Definition tr|A9P297|A9P297_PICSI Putative uncharacterized protein OS=Picea sitchensis
Align length 166
Score (bit) 201.0
E-value 2.0e-50
Report
BLASTX 2.2.19 [Nov-02-2008]


Reference: Altschul, Stephen F., Thomas L. Madden, Alejandro A. Schaffer,
Jinghui Zhang, Zheng Zhang, Webb Miller, and David J. Lipman (1997),
"Gapped BLAST and PSI-BLAST: a new generation of protein database search
programs", Nucleic Acids Res. 25:3389-3402.

Query= BP918356|Adiantum capillus-veneris mRNA, clone:
YMU001_000112_E08.
(566 letters)

Database: uniprot_trembl.fasta
7,341,751 sequences; 2,391,615,440 total letters

Searching..................................................done



Score E
Sequences producing significant alignments: (bits) Value

tr|A9P297|A9P297_PICSI Putative uncharacterized protein OS=Picea... 201 2e-50
tr|Q2VCI0|Q2VCI0_SOLTU Translocon-associated protein beta family... 183 5e-45
tr|A9PCS0|A9PCS0_POPTR Putative uncharacterized protein OS=Popul... 176 6e-43
tr|Q655K7|Q655K7_ORYSJ Putative uncharacterized protein P0672D08... 175 2e-42
tr|B7ENG6|B7ENG6_ORYSJ cDNA clone:J023002L13, full insert sequen... 174 3e-42
tr|B6TGJ2|B6TGJ2_MAIZE Translocon-associated protein beta contai... 172 9e-42
tr|B6SN99|B6SN99_MAIZE Translocon-associated protein beta contai... 172 9e-42
tr|B4FTC9|B4FTC9_MAIZE Putative uncharacterized protein OS=Zea m... 172 9e-42
tr|Q7F2E5|Q7F2E5_ORYSJ P0402A09.25 protein (P0455C04.19 protein)... 167 3e-40
tr|B7EUG6|B7EUG6_ORYSJ cDNA clone:J033125H15, full insert sequen... 157 5e-37
tr|Q94BY3|Q94BY3_ARATH AT5g14030/MUA22_2 (Putative uncharacteriz... 156 7e-37
tr|A5BI68|A5BI68_VITVI Putative uncharacterized protein (Fragmen... 155 1e-36
tr|Q9FMU7|Q9FMU7_ARATH Genomic DNA, chromosome 5, P1 clone:MUA22... 151 3e-35
tr|B8AWJ6|B8AWJ6_ORYSI Putative uncharacterized protein OS=Oryza... 150 5e-35
tr|B8ACS3|B8ACS3_ORYSI Putative uncharacterized protein OS=Oryza... 149 8e-35
tr|A7PA07|A7PA07_VITVI Chromosome chr14 scaffold_9, whole genome... 149 1e-34
tr|Q0JRG3|Q0JRG3_ORYSJ Os01g0102700 protein OS=Oryza sativa subs... 143 6e-33
tr|A2ZN97|A2ZN97_ORYSJ Putative uncharacterized protein OS=Oryza... 142 1e-32
tr|A3AZ20|A3AZ20_ORYSJ Putative uncharacterized protein OS=Oryza... 139 1e-31
tr|A9PBP2|A9PBP2_POPTR Putative uncharacterized protein OS=Popul... 129 1e-28
tr|Q0DLG8|Q0DLG8_ORYSJ Os05g0103100 protein OS=Oryza sativa subs... 126 7e-28
tr|B4FPY4|B4FPY4_MAIZE Putative uncharacterized protein OS=Zea m... 110 5e-23
tr|B6RB52|B6RB52_HALDI Signal sequence receptor beta-like protei... 65 2e-09
tr|B5FY73|B5FY73_TAEGU Putative signal sequence receptor beta va... 63 1e-08
tr|B0JYM9|B0JYM9_BOVIN SSR2 protein OS=Bos taurus GN=SSR2 PE=2 SV=1 63 1e-08
tr|B5FY74|B5FY74_TAEGU Putative signal sequence receptor beta va... 62 2e-08
tr|Q5ZLW9|Q5ZLW9_CHICK Putative uncharacterized protein OS=Gallu... 61 4e-08
tr|Q98SP1|Q98SP1_XENLA Signal sequence receptor beta subunit (MG... 60 8e-08
tr|Q6DK88|Q6DK88_XENTR MGC69435 protein (Signal sequence recepto... 60 1e-07
tr|Q70ML7|Q70ML7_CRAGI Signal sequence receptor beta-like protei... 60 1e-07

>tr|A9P297|A9P297_PICSI Putative uncharacterized protein OS=Picea
sitchensis PE=2 SV=1
Length = 192

Score = 201 bits (511), Expect = 2e-50
Identities = 98/166 (59%), Positives = 128/166 (77%), Gaps = 1/166 (0%)
Frame = +2

Query: 71 ATDEAFLVVHKRASISKLKS-VEHVTVSISLHNVGFSTAYDVSLNDDTWPSEKFNLVNGN 247
A + F+VVHK+ S++K KS E VTVSI L+N G +TAYDVSL DD+WPS+ F+LV+GN
Sbjct: 22 AAETPFMVVHKKVSLNKGKSDTERVTVSIDLYNRGSTTAYDVSLIDDSWPSDTFSLVSGN 81

Query: 248 ASNSWDKLEAGKSVVHVFVLESREKGLFYGAPAVVRYRITGKSALQEAFSTPIHELDLLA 427
S +WDKL+ G SV H FVLES+ KGLFYG PAVV+YR+ KS LQEA+S+PI LD+LA
Sbjct: 82 TSFTWDKLDVGASVSHTFVLESKVKGLFYGRPAVVKYRVAAKSVLQEAYSSPIPPLDILA 141

Query: 428 EKSSEQKFLWLKDFAVKYGPLVSVLSAISLFTYLLITPTKSKAAKA 565
E++ E+K+ W K A KYGPL SVLS + LF YL+++P+KS +K+
Sbjct: 142 ERAPEKKYEWAKKLAAKYGPLTSVLSIVGLFVYLMVSPSKSSNSKS 187


>tr|Q2VCI0|Q2VCI0_SOLTU Translocon-associated protein beta family
protein-like OS=Solanum tuberosum PE=2 SV=1
Length = 192

Score = 183 bits (465), Expect = 5e-45
Identities = 88/166 (53%), Positives = 125/166 (75%), Gaps = 1/166 (0%)
Frame = +2

Query: 68 SATDEAFLVVHKRASISKLKS-VEHVTVSISLHNVGFSTAYDVSLNDDTWPSEKFNLVNG 244
+A+D F+V HK+A++++LKS +E +++SI ++N G +TAYDVSL DD W + F +V G
Sbjct: 24 AASDGPFIVAHKKAALTRLKSDIERISISIDIYNEGSATAYDVSLYDDNWSQDVFEIVAG 83

Query: 245 NASNSWDKLEAGKSVVHVFVLESREKGLFYGAPAVVRYRITGKSALQEAFSTPIHELDLL 424
N S SW++L+AG S+ H F LE+++K +FYGAPAV+ +RI K+ALQEAFSTPI LD+L
Sbjct: 84 NTSMSWERLDAGASLSHSFELEAKKKTVFYGAPAVITFRIPTKAALQEAFSTPILPLDIL 143

Query: 425 AEKSSEQKFLWLKDFAVKYGPLVSVLSAISLFTYLLITPTKSKAAK 562
A++ E+KF W K KYG L+SV+S + LF YLL +P+KS AAK
Sbjct: 144 ADRPPEKKFDWAKKLMAKYGSLISVISIVVLFVYLLASPSKSNAAK 189


>tr|A9PCS0|A9PCS0_POPTR Putative uncharacterized protein OS=Populus
trichocarpa PE=2 SV=1
Length = 196

Score = 176 bits (447), Expect = 6e-43
Identities = 89/167 (53%), Positives = 121/167 (72%), Gaps = 1/167 (0%)
Frame = +2

Query: 68 SATDEAFLVVHKRASISKLKS-VEHVTVSISLHNVGFSTAYDVSLNDDTWPSEKFNLVNG 244
+++D F+V HK+A+ LKS E V+VSI ++N G STAYD++L DD WP + F++V+G
Sbjct: 25 ASSDVPFIVAHKKATPRGLKSGAERVSVSIDIYNQGSSTAYDITLTDDHWPKDIFDVVSG 84

Query: 245 NASNSWDKLEAGKSVVHVFVLESREKGLFYGAPAVVRYRITGKSALQEAFSTPIHELDLL 424
N S SWD+L+AG + H F LE + KG+F+G+PAV+ +RI K+ALQEA+STPI LD+L
Sbjct: 85 NTSQSWDRLDAGGLLSHAFELEGKVKGMFHGSPAVITFRIPTKAALQEAYSTPILPLDVL 144

Query: 425 AEKSSEQKFLWLKDFAVKYGPLVSVLSAISLFTYLLITPTKSKAAKA 565
AEK QK K KYG L+SV+S + LF YLL+TP+KS AAKA
Sbjct: 145 AEKPPVQKLELAKKLLAKYGSLISVISIVVLFIYLLVTPSKSGAAKA 191


>tr|Q655K7|Q655K7_ORYSJ Putative uncharacterized protein P0672D08.46
OS=Oryza sativa subsp. japonica GN=P0672D08.46 PE=4 SV=1
Length = 190

Score = 175 bits (443), Expect = 2e-42
Identities = 85/168 (50%), Positives = 120/168 (71%), Gaps = 1/168 (0%)
Frame = +2

Query: 65 TSATDEAFLVVHKRASISKLK-SVEHVTVSISLHNVGFSTAYDVSLNDDTWPSEKFNLVN 241
+++ D FLV HK+ S+S+ K VE + VS+ L+N G +TAYDVS+NDDTWP E F LV+
Sbjct: 18 SASADAPFLVAHKKVSLSRPKPGVERLAVSLDLYNQGSATAYDVSINDDTWPKEAFELVS 77

Query: 242 GNASNSWDKLEAGKSVVHVFVLESREKGLFYGAPAVVRYRITGKSALQEAFSTPIHELDL 421
G S + ++L+ G + H FVLE++ +G F G+PAV+ YR+ K+ALQEA+STPI LD+
Sbjct: 78 GEMSKTLERLDPGVTASHAFVLETKVQGRFQGSPAVITYRVPTKAALQEAYSTPILALDV 137

Query: 422 LAEKSSEQKFLWLKDFAVKYGPLVSVLSAISLFTYLLITPTKSKAAKA 565
LAE+ E+KF W+K KYG LVSV+ + +F YL+ +P+KS AKA
Sbjct: 138 LAERPPEKKFEWVKRLVAKYGSLVSVVGLVGVFIYLVASPSKSSGAKA 185


>tr|B7ENG6|B7ENG6_ORYSJ cDNA clone:J023002L13, full insert sequence
OS=Oryza sativa subsp. japonica PE=2 SV=1
Length = 190

Score = 174 bits (441), Expect = 3e-42
Identities = 85/168 (50%), Positives = 119/168 (70%), Gaps = 1/168 (0%)
Frame = +2

Query: 65 TSATDEAFLVVHKRASISKLK-SVEHVTVSISLHNVGFSTAYDVSLNDDTWPSEKFNLVN 241
+++ D FLV HK+ S+S+ K VE + VS+ L+N G +TAYDVS+NDDTWP E F LV+
Sbjct: 18 SASADAPFLVAHKKVSLSRPKPGVERLAVSLDLYNQGSATAYDVSINDDTWPKEAFELVS 77

Query: 242 GNASNSWDKLEAGKSVVHVFVLESREKGLFYGAPAVVRYRITGKSALQEAFSTPIHELDL 421
G S + ++L+ G + H FVLE++ +G F G+PAV+ YR+ K+ALQEA+STPI LD+
Sbjct: 78 GEMSKTLERLDPGVTASHAFVLETKVQGRFQGSPAVITYRVPTKAALQEAYSTPILALDV 137

Query: 422 LAEKSSEQKFLWLKDFAVKYGPLVSVLSAISLFTYLLITPTKSKAAKA 565
LAE+ E+KF W K KYG LVSV+ + +F YL+ +P+KS AKA
Sbjct: 138 LAERPPEKKFEWAKRLVAKYGSLVSVVGLVGVFIYLVASPSKSSGAKA 185


>tr|B6TGJ2|B6TGJ2_MAIZE Translocon-associated protein beta
containing protein OS=Zea mays PE=2 SV=1
Length = 190

Score = 172 bits (437), Expect = 9e-42
Identities = 83/164 (50%), Positives = 117/164 (71%), Gaps = 1/164 (0%)
Frame = +2

Query: 68 SATDEAFLVVHKRASISKLK-SVEHVTVSISLHNVGFSTAYDVSLNDDTWPSEKFNLVNG 244
SA D F+V HK+ S+S+ K VE V VS+ L+N G +TAYDVSLNDD+WP++ F LV G
Sbjct: 20 SAADAPFVVAHKKVSLSRPKPGVERVAVSLDLYNQGSATAYDVSLNDDSWPTQAFELVTG 79

Query: 245 NASNSWDKLEAGKSVVHVFVLESREKGLFYGAPAVVRYRITGKSALQEAFSTPIHELDLL 424
S + ++L+ G + H +VLE++ +G F G+PA++ YR+ K+ALQEA+STPI LD+L
Sbjct: 80 EKSKTLERLDPGATATHTYVLETKTQGRFQGSPAIITYRVPTKTALQEAYSTPIFPLDIL 139

Query: 425 AEKSSEQKFLWLKDFAVKYGPLVSVLSAISLFTYLLITPTKSKA 556
AE+ E+KF W K KYG LVSV+S + LF YL+ +P+KS +
Sbjct: 140 AERLPEKKFEWAKRLVAKYGSLVSVVSFVGLFIYLVASPSKSSS 183


>tr|B6SN99|B6SN99_MAIZE Translocon-associated protein beta
containing protein OS=Zea mays PE=2 SV=1
Length = 191

Score = 172 bits (437), Expect = 9e-42
Identities = 86/168 (51%), Positives = 121/168 (72%), Gaps = 3/168 (1%)
Frame = +2

Query: 68 SATDEAFLVVHKRASISKLK-SVEHVTVSISLHNVGFSTAYDVSLNDDTWPSEKFNLVNG 244
SA D F+V HK+ S+S+ K VE V VS+ L+N G +TAYDVS+NDD+WP+E F LV G
Sbjct: 21 SAADAPFVVAHKKISLSRPKPGVERVAVSLDLYNQGSATAYDVSINDDSWPTEVFELVTG 80

Query: 245 NASNSWDKLEAGKSVVHVFVLESREKGLFYGAPAVVRYRITGKSALQEAFSTPIHELDLL 424
S + ++L+ G + H +VLE++ +G F G+PA++ YR+ K+ALQEA+STPI LD+L
Sbjct: 81 EKSKTLERLDPGATASHTYVLETKTQGRFQGSPAIITYRVPTKTALQEAYSTPIFPLDIL 140

Query: 425 AEKSSEQKFLWLKDFAVKYGPLVSVLSAISLFTYLLITPTK--SKAAK 562
AE+ E+KF W K +KYG LVSV+S + LF YL+ +P+K SKA+K
Sbjct: 141 AERPPEKKFEWAKRLVMKYGSLVSVVSFVGLFIYLVASPSKSSSKASK 188


>tr|B4FTC9|B4FTC9_MAIZE Putative uncharacterized protein OS=Zea mays
PE=2 SV=1
Length = 190

Score = 172 bits (437), Expect = 9e-42
Identities = 86/168 (51%), Positives = 121/168 (72%), Gaps = 3/168 (1%)
Frame = +2

Query: 68 SATDEAFLVVHKRASISKLK-SVEHVTVSISLHNVGFSTAYDVSLNDDTWPSEKFNLVNG 244
SA D F+V HK+ S+S+ K VE V VS+ L+N G +TAYDVS+NDD+WP+E F LV G
Sbjct: 20 SAADAPFVVAHKKISLSRPKPGVERVAVSLDLYNQGSATAYDVSINDDSWPTEVFELVTG 79

Query: 245 NASNSWDKLEAGKSVVHVFVLESREKGLFYGAPAVVRYRITGKSALQEAFSTPIHELDLL 424
S + ++L+ G + H +VLE++ +G F G+PA++ YR+ K+ALQEA+STPI LD+L
Sbjct: 80 EKSKTLERLDPGATASHTYVLETKTQGRFQGSPAIITYRVPTKTALQEAYSTPIFPLDIL 139

Query: 425 AEKSSEQKFLWLKDFAVKYGPLVSVLSAISLFTYLLITPTK--SKAAK 562
AE+ E+KF W K +KYG LVSV+S + LF YL+ +P+K SKA+K
Sbjct: 140 AERPPEKKFEWAKRLVMKYGSLVSVVSFVGLFIYLVASPSKSSSKASK 187


>tr|Q7F2E5|Q7F2E5_ORYSJ P0402A09.25 protein (P0455C04.19 protein)
OS=Oryza sativa subsp. japonica GN=P0402A09.25 PE=4 SV=1
Length = 188

Score = 167 bits (424), Expect = 3e-40
Identities = 84/168 (50%), Positives = 118/168 (70%), Gaps = 1/168 (0%)
Frame = +2

Query: 65 TSATDEAFLVVHKRASISKLK-SVEHVTVSISLHNVGFSTAYDVSLNDDTWPSEKFNLVN 241
+++ D FLV HK+ S+S+ K VE + VS+ L+N G +TAYDVS+NDDTWP E F LV+
Sbjct: 18 SASADAPFLVAHKKVSLSRPKPGVERLAVSLDLYNQGSATAYDVSINDDTWPKEAFELVS 77

Query: 242 GNASNSWDKLEAGKSVVHVFVLESREKGLFYGAPAVVRYRITGKSALQEAFSTPIHELDL 421
G S + ++L+ G + H FVLE++ +G F G+PAV+ YR+ K+ALQEA+STPI LD+
Sbjct: 78 GEMSKTLERLDPGVTASHAFVLETKVQGRFQGSPAVITYRVPTKAALQEAYSTPILALDV 137

Query: 422 LAEKSSEQKFLWLKDFAVKYGPLVSVLSAISLFTYLLITPTKSKAAKA 565
LAE+ E+KF W KYG LVSV+ + +F YL+ +P+KS AKA
Sbjct: 138 LAERPPEKKFEW--RLVAKYGSLVSVVGLVGVFIYLVASPSKSSGAKA 183


>tr|B7EUG6|B7EUG6_ORYSJ cDNA clone:J033125H15, full insert sequence
OS=Oryza sativa subsp. japonica PE=2 SV=1
Length = 194

Score = 157 bits (396), Expect = 5e-37
Identities = 77/163 (47%), Positives = 114/163 (69%), Gaps = 1/163 (0%)
Frame = +2

Query: 77 DEAFLVVHKRASISKL-KSVEHVTVSISLHNVGFSTAYDVSLNDDTWPSEKFNLVNGNAS 253
D F+V K+ ++S+ VE + V+++L+N G +TAYDVSLNDD+WP E F L++G S
Sbjct: 26 DAPFVVAQKKVALSRPGPGVERLAVTLNLYNQGSATAYDVSLNDDSWPQEAFQLISGTTS 85

Query: 254 NSWDKLEAGKSVVHVFVLESREKGLFYGAPAVVRYRITGKSALQEAFSTPIHELDLLAEK 433
+KL+ G + H F+LE++ +G F G+PA++ YR+ K+ALQEA+STP+ LD+LAE+
Sbjct: 86 KIVEKLDPGATASHNFILETKVQGKFQGSPAIITYRVPTKAALQEAYSTPMFPLDILAER 145

Query: 434 SSEQKFLWLKDFAVKYGPLVSVLSAISLFTYLLITPTKSKAAK 562
+QKF K KYG LVSV+S + +F YL+ +P+KS AAK
Sbjct: 146 PPQQKFELAKRLVGKYGSLVSVVSFVGVFIYLVASPSKSTAAK 188