BP918390
Clone id YMU001_000112_H11
Library
Length 515
Definition Adiantum capillus-veneris mRNA. clone: YMU001_000112_H11.
Accession
Tissue type prothallium
Developmental stage -
Contig ID -
Sequence
CACTCAATTAAGTTTGGATGGCGCCTCCAAACATTCAACAGCTTTACAAGGCGGGTTGCA
GCAGGTGAAGGGCCATATTGGTAACCCAGGCGGCCCGTTTGATACTTACTTTGATATCTC
TAACTTTCTACGCCACCTGGAACACAAGCAGTCTCCGGCTTACGGGAAACAGCAAGGTTT
ACGTCTGCACTTTCCATTCCCCTTTTCGGCCCTCTCCTTCATTAGAAAGAGGGGCAAGAA
TACACAGGTTCTGGACTCAAGCACCATAGCCCACTCCCTTGTTGTCATCAGCACCGTTGA
CCTTGAGATCCGGAATGAGCTGAATAAACAAGTGCATTCTTTGAAGGACGAAGAAGATGT
GGGATCACCCTTCATTCATAGCTCCATTCCAGATAACCTCCGATTACAAAGTTCAAGTCC
ACTCAGTGTTGCCATGCAGAGTGAAGATACCACAGTCATGGATGGGCATCACACGTGTGA
TCACAGCAATAAAAAATATTTCAGTACTTCTATGG
■■Homology search results ■■ -
sp_hit_id Q9LTM6
Definition sp|Q9LTM6|C71BH_ARATH Cytochrome P450 71B17 OS=Arabidopsis thaliana
Align length 142
Score (bit) 34.7
E-value 0.27
Report
BLASTX 2.2.19 [Nov-02-2008]


Reference: Altschul, Stephen F., Thomas L. Madden, Alejandro A. Schaffer,
Jinghui Zhang, Zheng Zhang, Webb Miller, and David J. Lipman (1997),
"Gapped BLAST and PSI-BLAST: a new generation of protein database search
programs", Nucleic Acids Res. 25:3389-3402.

Query= BP918390|Adiantum capillus-veneris mRNA, clone:
YMU001_000112_H11.
(515 letters)

Database: uniprot_sprot.fasta
412,525 sequences; 148,809,765 total letters

Searching..................................................done



Score E
Sequences producing significant alignments: (bits) Value

sp|Q9LTM6|C71BH_ARATH Cytochrome P450 71B17 OS=Arabidopsis thali... 35 0.27
sp|B0REB7|Y715_CLAMS UPF0082 protein CMS0715 OS=Clavibacter mich... 32 2.3
sp|A5CS09|Y1817_CLAM3 UPF0082 protein CMM_1817 OS=Clavibacter mi... 32 2.3
sp|O73579|VD4L_CWPXG Ankyrin repeat protein D4L/I2R OS=Cowpox vi... 31 3.0
sp|Q91474|HNF1A_SALSA Hepatocyte nuclear factor 1-alpha OS=Salmo... 31 3.9
sp|A0QWH1|Y2940_MYCS2 UPF0082 protein MSMEG_2940 OS=Mycobacteriu... 30 5.1
sp|A0AJC9|MEND_LISW6 2-succinyl-5-enolpyruvyl-6-hydroxy-3-cycloh... 30 5.1
sp|Q8T158|FAM91_DICDI Protein FAM91 homolog OS=Dictyostelium dis... 30 6.7
sp|O74421|COQ3_SCHPO Hexaprenyldihydroxybenzoate methyltransfera... 30 6.7
sp|Q51423|Y964_PSEAE UPF0082 protein PA0964 OS=Pseudomonas aerug... 30 8.7
sp|Q02IC6|Y5181_PSEAB UPF0082 protein PA14_51810 OS=Pseudomonas ... 30 8.7
sp|A6VA08|Y4544_PSEA7 UPF0082 protein PSPA7_4544 OS=Pseudomonas ... 30 8.7
sp|Q9LTM7|C71BG_ARATH Cytochrome P450 71B16 OS=Arabidopsis thali... 30 8.7

>sp|Q9LTM6|C71BH_ARATH Cytochrome P450 71B17 OS=Arabidopsis thaliana
GN=CYP71B17 PE=2 SV=1
Length = 502

Score = 34.7 bits (78), Expect = 0.27
Identities = 37/142 (26%), Positives = 60/142 (42%), Gaps = 4/142 (2%)
Frame = +2

Query: 56 LQQVKGHIGNPGGPFDTYFDISNFLRHLEHKQSPAYGKQQGLRLHFPFPFSALSFIRKRG 235
LQ V NPG D + DI + + + HKQ GK LRL L+ I G
Sbjct: 251 LQHVIDDHSNPGRSKD-HKDIVDVMLDVMHKQ----GKDDSLRLTIDHIKGLLTNIIIAG 305

Query: 236 KNTQVLDS----STIAHSLVVISTVDLEIRNELNKQVHSLKDEEDVGSPFIHSSIPDNLR 403
+T L + +A + ++ V EIR+ L + E+ PF++ I + R
Sbjct: 306 IDTGALTMIWTMTELARNPEIMKKVQGEIRDRLGNNRERITKEDLDKVPFLNLVIKETFR 365

Query: 404 LQSSSPLSVAMQSEDTTVMDGH 469
L +PL + ++ + G+
Sbjct: 366 LHPVAPLLLPRETMAHVKVQGY 387


>sp|B0REB7|Y715_CLAMS UPF0082 protein CMS0715 OS=Clavibacter
michiganensis subsp. sepedonicus (strain ATCC 33113 /
JCM 9667) GN=CMS0715 PE=3 SV=1
Length = 255

Score = 31.6 bits (70), Expect = 2.3
Identities = 15/50 (30%), Positives = 31/50 (62%)
Frame = +2

Query: 254 DSSTIAHSLVVISTVDLEIRNELNKQVHSLKDEEDVGSPFIHSSIPDNLR 403
DS+ + V VDLE ++NK V +++D +DV + +++S +P +++
Sbjct: 197 DSADVEFVPQVKVEVDLETARKVNKLVDAMEDLDDVQNIYVNSDVPADVQ 246


>sp|A5CS09|Y1817_CLAM3 UPF0082 protein CMM_1817 OS=Clavibacter
michiganensis subsp. michiganensis (strain NCPPB 382)
GN=CMM_1817 PE=3 SV=1
Length = 255

Score = 31.6 bits (70), Expect = 2.3
Identities = 15/50 (30%), Positives = 31/50 (62%)
Frame = +2

Query: 254 DSSTIAHSLVVISTVDLEIRNELNKQVHSLKDEEDVGSPFIHSSIPDNLR 403
DS+ + V VDLE ++NK V +++D +DV + +++S +P +++
Sbjct: 197 DSADVEFVPQVKVEVDLETARKVNKLVDAMEDLDDVQNIYVNSDVPADVQ 246


>sp|O73579|VD4L_CWPXG Ankyrin repeat protein D4L/I2R OS=Cowpox virus
(strain GRI-90 / Grishak) GN=D4L PE=4 SV=1
Length = 672

Score = 31.2 bits (69), Expect = 3.0
Identities = 19/63 (30%), Positives = 35/63 (55%), Gaps = 1/63 (1%)
Frame = +2

Query: 290 STVDLEIRNELNKQVHSLKDEEDVGSPFIHSSIPDNLRLQ-SSSPLSVAMQSEDTTVMDG 466
ST+D+EI L K V + + +D+ P+I + D L + +P +V M+ + +++G
Sbjct: 247 STIDIEIVKLLIKDVDTCRVYDDISQPYIRGVLADYLNKRFRVTPYNVDMEIVN-LLIEG 305

Query: 467 HHT 475
HT
Sbjct: 306 RHT 308


>sp|Q91474|HNF1A_SALSA Hepatocyte nuclear factor 1-alpha OS=Salmo
salar GN=hnf1a PE=2 SV=1
Length = 559

Score = 30.8 bits (68), Expect = 3.9
Identities = 35/134 (26%), Positives = 53/134 (39%)
Frame = +2

Query: 32 HSTALQGGLQQVKGHIGNPGGPFDTYFDISNFLRHLEHKQSPAYGKQQGLRLHFPFPFSA 211
HST+ Q QQ + H+G+ PF Q P + + H+P P S
Sbjct: 417 HSTSQQQLTQQFQSHMGHHHSPFMATM-----------AQLPCHMYSKSDMSHYP-PSSL 464

Query: 212 LSFIRKRGKNTQVLDSSTIAHSLVVISTVDLEIRNELNKQVHSLKDEEDVGSPFIHSSIP 391
LS V+ S+ +L ++TV +Q+ + EE P
Sbjct: 465 LS-------QAMVITDSSSLGTLTSLTTV---------RQILTTDPEEQTDQPIQE---- 504

Query: 392 DNLRLQSSSPLSVA 433
D+L LQS SP+ V+
Sbjct: 505 DSLHLQSPSPVPVS 518


>sp|A0QWH1|Y2940_MYCS2 UPF0082 protein MSMEG_2940 OS=Mycobacterium
smegmatis GN=MSMEG_2940 PE=3 SV=1
Length = 251

Score = 30.4 bits (67), Expect = 5.1
Identities = 17/52 (32%), Positives = 28/52 (53%)
Frame = +2

Query: 254 DSSTIAHSLVVISTVDLEIRNELNKQVHSLKDEEDVGSPFIHSSIPDNLRLQ 409
DS+ + V VDLE ++ K V +L+D +DV + + IPD++ Q
Sbjct: 196 DSADASFQPSVTVPVDLEGARKVLKLVDALEDSDDVQDVYTNMDIPDDVAAQ 247


>sp|A0AJC9|MEND_LISW6
2-succinyl-5-enolpyruvyl-6-hydroxy-3-cyclohexene-1-
carboxylate synthase OS=Listeria welshimeri serovar 6b
(strain ATCC 35897 / DSM 20650 / SLCC5334) GN=menD PE=3
SV=1
Length = 580

Score = 30.4 bits (67), Expect = 5.1
Identities = 17/43 (39%), Positives = 23/43 (53%)
Frame = +1

Query: 139 GTQAVSGLRETARFTSALSIPLFGPLLH*KEGQEYTGSGLKHH 267
G++AV +T R L+ PL PL+ E YT +G KHH
Sbjct: 154 GSRAVDIAMKTPRGPVHLNFPLREPLVPILEPSPYTATGKKHH 196


>sp|Q8T158|FAM91_DICDI Protein FAM91 homolog OS=Dictyostelium
discoideum GN=fam91 PE=3 SV=2
Length = 930

Score = 30.0 bits (66), Expect = 6.7
Identities = 27/137 (19%), Positives = 53/137 (38%), Gaps = 6/137 (4%)
Frame = +2

Query: 98 FDTYFDISNFLRHLEHKQSPAYGKQQGLRLHFPFPFSALSFIRKRGKN-TQVLDSSTIAH 274
+DT +S + H + K L H PFP LS K T ++ ++T
Sbjct: 658 YDTQPKLSKLMSHSRSNSIVSSSKDNQLLYHIPFPLDDLSADNGSPKKYTNIITNNTTTT 717

Query: 275 SLVVISTVDLEIRNELNKQVHSLKDEEDVGSPFIHS-----SIPDNLRLQSSSPLSVAMQ 439
+ +T N N +++ E+ S IH+ I L++S ++
Sbjct: 718 TTTTTTT------NTTNLNNNTIISEDQYNSDNIHTHPILYKIQSTFNLKNSFGYITLLK 771

Query: 440 SEDTTVMDGHHTCDHSN 490
E +++ ++ ++ N
Sbjct: 772 KETHILLNNNNNNNNKN 788


>sp|O74421|COQ3_SCHPO Hexaprenyldihydroxybenzoate methyltransferase,
mitochondrial OS=Schizosaccharomyces pombe GN=coq3 PE=2
SV=1
Length = 271

Score = 30.0 bits (66), Expect = 6.7
Identities = 24/105 (22%), Positives = 45/105 (42%), Gaps = 3/105 (2%)
Frame = +2

Query: 8 LSLDGASKHST---ALQGGLQQVKGHIGNPGGPFDTYFDISNFLRHLEHKQSPAYGKQQG 178
++++ A KH++ L G L+ + G + G T FD+ + LEH + P
Sbjct: 110 MAIEVAKKHASLDPVLNGRLEYIHGSV--EGSQLPTTFDVVTCMEVLEHVEQPR------ 161

Query: 179 LRLHFPFPFSALSFIRKRGKNTQVLDSSTIAHSLVVISTVDLEIR 313
F FS + ++ G+ S T+ L+ I+ + +R
Sbjct: 162 -----DFLFSLMEKVKPNGRLVLSTISRTLLARLLTITLAEHVLR 201


>sp|Q51423|Y964_PSEAE UPF0082 protein PA0964 OS=Pseudomonas
aeruginosa GN=PA0964 PE=3 SV=2
Length = 248

Score = 29.6 bits (65), Expect = 8.7
Identities = 13/40 (32%), Positives = 26/40 (65%)
Frame = +2

Query: 290 STVDLEIRNELNKQVHSLKDEEDVGSPFIHSSIPDNLRLQ 409
+T+DLE ++ K + L+D +DV + + ++ IPD++ Q
Sbjct: 207 ATLDLETAQKVLKLIDMLEDLDDVQNVYSNADIPDDVMAQ 246


tr_hit_id B6BR36
Definition tr|B6BR36|B6BR36_9RICK Putative uncharacterized protein OS=Candidatus Pelagibacter sp. HTCC7211
Align length 69
Score (bit) 35.4
E-value 1.7
Report
BLASTX 2.2.19 [Nov-02-2008]


Reference: Altschul, Stephen F., Thomas L. Madden, Alejandro A. Schaffer,
Jinghui Zhang, Zheng Zhang, Webb Miller, and David J. Lipman (1997),
"Gapped BLAST and PSI-BLAST: a new generation of protein database search
programs", Nucleic Acids Res. 25:3389-3402.

Query= BP918390|Adiantum capillus-veneris mRNA, clone:
YMU001_000112_H11.
(515 letters)

Database: uniprot_trembl.fasta
7,341,751 sequences; 2,391,615,440 total letters

Searching..................................................done



Score E
Sequences producing significant alignments: (bits) Value

tr|B6BR36|B6BR36_9RICK Putative uncharacterized protein OS=Candi... 35 1.7
tr|B2UQL5|B2UQL5_AKKM8 FolC bifunctional protein OS=Akkermansia ... 34 3.7
tr|A6C1N1|A6C1N1_9PLAN Uroporphyrin-III C-methyltransferase OS=P... 34 3.7
tr|B5YNX6|B5YNX6_THAPS Predicted protein OS=Thalassiosira pseudo... 34 4.9
tr|A0RQG7|A0RQG7_CAMFF Argininosuccinate lyase OS=Campylobacter ... 33 6.4
tr|O64631|O64631_ARATH Putative cytochrome P450 (At2g45510) OS=A... 33 6.4
tr|Q6Z3P7|Q6Z3P7_ORYSJ Putative uncharacterized protein OSJNBa00... 33 8.3
tr|Q0WQP8|Q0WQP8_ARATH Putative uncharacterized protein At2g4183... 33 8.3
tr|O81469|O81469_ARATH T15F16.13 protein (Putative uncharacteriz... 33 8.3
tr|O22937|O22937_ARATH Putative uncharacterized protein At2g4183... 33 8.3
tr|A7PW83|A7PW83_VITVI Chromosome chr8 scaffold_34, whole genome... 33 8.3
tr|A3BJ37|A3BJ37_ORYSJ Putative uncharacterized protein OS=Oryza... 33 8.3
tr|B6NC22|B6NC22_BRAFL Putative uncharacterized protein (Fragmen... 33 8.3
tr|B6N3U7|B6N3U7_BRAFL Putative uncharacterized protein OS=Branc... 33 8.3

>tr|B6BR36|B6BR36_9RICK Putative uncharacterized protein
OS=Candidatus Pelagibacter sp. HTCC7211 GN=PB7211_1245
PE=4 SV=1
Length = 265

Score = 35.4 bits (80), Expect = 1.7
Identities = 18/69 (26%), Positives = 40/69 (57%), Gaps = 3/69 (4%)
Frame = +2

Query: 272 HSLVVISTVD---LEIRNELNKQVHSLKDEEDVGSPFIHSSIPDNLRLQSSSPLSVAMQS 442
H L+ I+ ++ L + E+NK + K+ +V SPF++ + + L +Q+ LS+ +
Sbjct: 62 HKLIKINDLNNFRLSLIQEVNKDKNFRKEYYNVASPFLNEIVGNELVMQNRVNLSIQLPK 121

Query: 443 EDTTVMDGH 469
+ ++++D H
Sbjct: 122 DKSSLLDVH 130


>tr|B2UQL5|B2UQL5_AKKM8 FolC bifunctional protein OS=Akkermansia
muciniphila (strain ATCC BAA-835) GN=Amuc_0918 PE=4 SV=1
Length = 404

Score = 34.3 bits (77), Expect = 3.7
Identities = 15/35 (42%), Positives = 24/35 (68%)
Frame = +2

Query: 326 KQVHSLKDEEDVGSPFIHSSIPDNLRLQSSSPLSV 430
+++ +L E++ G FIHSS+PD L+ +SPL V
Sbjct: 344 EEMAALLGEQETGPVFIHSSLPDGLQAALASPLPV 378


>tr|A6C1N1|A6C1N1_9PLAN Uroporphyrin-III C-methyltransferase
OS=Planctomyces maris DSM 8797 GN=PM8797T_12918 PE=3
SV=1
Length = 509

Score = 34.3 bits (77), Expect = 3.7
Identities = 22/61 (36%), Positives = 31/61 (50%), Gaps = 5/61 (8%)
Frame = +3

Query: 36 QQLYKAGCSR*RAILVTQAARLILTLISLTFY-----ATWNTSSLRLTGNSKVYVCTFHS 200
Q L AG +R R +L T+ A++ T+ + Y A WNT SLRL + +V S
Sbjct: 383 QSLLWAGANRGREVLQTELAKVSATVEKVVVYENHDVAAWNTESLRLLESGEVDWVGLSS 442

Query: 201 P 203
P
Sbjct: 443 P 443


>tr|B5YNX6|B5YNX6_THAPS Predicted protein OS=Thalassiosira
pseudonana CCMP1335 GN=THAPS_7304 PE=4 SV=1
Length = 446

Score = 33.9 bits (76), Expect = 4.9
Identities = 26/71 (36%), Positives = 38/71 (53%), Gaps = 4/71 (5%)
Frame = +2

Query: 134 HLEHKQSPAYGKQQG-LRLHFPFPFSAL--SFIRKRGKNT-QVLDSSTIAHSLVVISTVD 301
H + K SPAY K++ LR + SAL + + GK T V D+S I HSL ++ +D
Sbjct: 206 HQQCKDSPAYNKEEKMLREKYKSSPSALGEALCEESGKRTAAVEDASMIGHSLQLVQWLD 265

Query: 302 LEIRNELNKQV 334
+ EL +V
Sbjct: 266 FLVEPELIAEV 276


>tr|A0RQG7|A0RQG7_CAMFF Argininosuccinate lyase OS=Campylobacter
fetus subsp. fetus (strain 82-40) GN=argH PE=4 SV=1
Length = 504

Score = 33.5 bits (75), Expect = 6.4
Identities = 36/138 (26%), Positives = 60/138 (43%), Gaps = 2/138 (1%)
Frame = +2

Query: 26 SKHSTALQGGLQQVKGHIGNPGGPFDTYFDISNFLRHLEHKQSPAYGKQQGLRLHFPFPF 205
++ S + GLQQVK I N F+ + + +E + S GK+ G +LH
Sbjct: 95 TEQSQKIINGLQQVKSEIDN--SEFEFKIENEDIHMAVEKRLSEIIGKELGGKLH----- 147

Query: 206 SALSFIRKRGKNTQV-LDSST-IAHSLVVISTVDLEIRNELNKQVHSLKDEEDVGSPFIH 379
R +N QV LD + V+IS + LE+ L +D+ + +
Sbjct: 148 ------TARSRNDQVALDFKLFVQQQSVIISNLILELMVVL----------KDIAAEHKN 191

Query: 380 SSIPDNLRLQSSSPLSVA 433
+ +P LQ + P+S+A
Sbjct: 192 TLMPGFTHLQHAQPISLA 209


>tr|O64631|O64631_ARATH Putative cytochrome P450 (At2g45510)
OS=Arabidopsis thaliana GN=At2g45510 PE=2 SV=1
Length = 511

Score = 33.5 bits (75), Expect = 6.4
Identities = 18/74 (24%), Positives = 33/74 (44%)
Frame = +2

Query: 293 TVDLEIRNELNKQVHSLKDEEDVGSPFIHSSIPDNLRLQSSSPLSVAMQSEDTTVMDGHH 472
T E ++N V S+ +E ++H+++ + LRL P+ + D + DGH
Sbjct: 339 TFSHEKTTDVNGFVESINEEALDEMHYLHAALSETLRLYPPVPVDMRCAENDDVLPDGHR 398

Query: 473 TCDHSNKKYFSTSM 514
N Y + +M
Sbjct: 399 VSKGDNIYYIAYAM 412


>tr|Q6Z3P7|Q6Z3P7_ORYSJ Putative uncharacterized protein
OSJNBa0084P08.24 OS=Oryza sativa subsp. japonica
GN=OSJNBa0084P08.24 PE=4 SV=1
Length = 207

Score = 33.1 bits (74), Expect = 8.3
Identities = 23/89 (25%), Positives = 36/89 (40%), Gaps = 2/89 (2%)
Frame = -3

Query: 333 TCLFSSFRISRSTVLMTTREWAMVLESRTCVFLPLFLMKERAEKGNGKCRRKPCCFP*AG 154
T + S +S TV +V T FL LM ++ + +C R+ C A
Sbjct: 109 TMVLDSVEVSNKTVASVASSRIVVDSGTTLTFLDSALMGPLVDELSHRCSRRTGCCSCAT 168

Query: 153 DCLCSRWR--RKLEISK*VSNGPPGLPIW 73
C RW+ R+ +I+ + P P W
Sbjct: 169 SCPGGRWKPERESQITSINISRSPDTPSW 197


>tr|Q0WQP8|Q0WQP8_ARATH Putative uncharacterized protein At2g41830
OS=Arabidopsis thaliana GN=At2g41830 PE=2 SV=1
Length = 1025

Score = 33.1 bits (74), Expect = 8.3
Identities = 23/88 (26%), Positives = 45/88 (51%)
Frame = +2

Query: 104 TYFDISNFLRHLEHKQSPAYGKQQGLRLHFPFPFSALSFIRKRGKNTQVLDSSTIAHSLV 283
T+F +S ++HL+HK + K ++L+ S+LS +++ + HS
Sbjct: 341 THFLLSMLIKHLDHK---SVLKHPSMQLNILEVTSSLS------------ETAKVEHSAT 385

Query: 284 VISTVDLEIRNELNKQVHSLKDEEDVGS 367
++S + +I L K +HS DE ++G+
Sbjct: 386 IVSAIS-DIMRHLRKCMHSSLDEANLGT 412


>tr|O81469|O81469_ARATH T15F16.13 protein (Putative uncharacterized
protein At4g08510) (At4g08510) OS=Arabidopsis thaliana
GN=AT4g08510 PE=2 SV=1
Length = 551

Score = 33.1 bits (74), Expect = 8.3
Identities = 21/67 (31%), Positives = 32/67 (47%)
Frame = +2

Query: 218 FIRKRGKNTQVLDSSTIAHSLVVISTVDLEIRNELNKQVHSLKDEEDVGSPFIHSSIPDN 397
++R G + V S++++ SL RN N+ S D + VGSPF+ S N
Sbjct: 12 WLRSSGHGSGVGSSNSLSDSL----------RNSKNRNARSRSDADSVGSPFLDRSSSTN 61

Query: 398 LRLQSSS 418
R SS+
Sbjct: 62 TRRGSSN 68


>tr|O22937|O22937_ARATH Putative uncharacterized protein At2g41830
OS=Arabidopsis thaliana GN=At2g41830 PE=2 SV=1
Length = 961

Score = 33.1 bits (74), Expect = 8.3
Identities = 23/88 (26%), Positives = 45/88 (51%)
Frame = +2

Query: 104 TYFDISNFLRHLEHKQSPAYGKQQGLRLHFPFPFSALSFIRKRGKNTQVLDSSTIAHSLV 283
T+F +S ++HL+HK + K ++L+ S+LS +++ + HS
Sbjct: 295 THFLLSMLIKHLDHK---SVLKHPSMQLNILEVTSSLS------------ETAKVEHSAT 339

Query: 284 VISTVDLEIRNELNKQVHSLKDEEDVGS 367
++S + +I L K +HS DE ++G+
Sbjct: 340 IVSAIS-DIMRHLRKCMHSSLDEANLGT 366