BP918391
Clone id YMU001_000113_A01
Library
Length 408
Definition Adiantum capillus-veneris mRNA. clone: YMU001_000113_A01.
Accession
Tissue type prothallium
Developmental stage -
Contig ID -
Sequence
CCCTCGAGGCCATAATTGCTACGTGACAAGAAAAGTGAGATGGGTTGGACGGGTGCATGT
ATTGAGAGTTGTAACAATGCCAATAACACAACCGCTGCACGACAAGAAAGTGAGGGGAGT
GAAACCTTCACATCGAGGGTTAATAACAATGCCATCATATTTGCCGGAAGTGTGCTGATG
CAACATCAAGCCAAATTCTTAGAAGAGATGCTCCACCTTCTACCCTTCACCAAGCTTCTC
AGCAGCTTTGCAGTCCCCATTCTCTTTGCCGCTTTAACTTCCACTCTTTCTCCTTTGCAA
TCTTCAAAGCATCTTCAAAACTCTGTGCTCTTTCCAACTTCATTTTCACTTTCAAACCCT
CGATGAGCAAAGCACTTCTTAAGCATGTCAGGCAGAACTTGATCTCCC
■■Homology search results ■■ -
sp_hit_id P38781
Definition sp|P38781|RSC30_YEAST Chromatin structure-remodeling complex protein RSC30 OS=Saccharomyces cerevisiae
Align length 44
Score (bit) 33.1
E-value 0.45
Report
BLASTX 2.2.19 [Nov-02-2008]


Reference: Altschul, Stephen F., Thomas L. Madden, Alejandro A. Schaffer,
Jinghui Zhang, Zheng Zhang, Webb Miller, and David J. Lipman (1997),
"Gapped BLAST and PSI-BLAST: a new generation of protein database search
programs", Nucleic Acids Res. 25:3389-3402.

Query= BP918391|Adiantum capillus-veneris mRNA, clone:
YMU001_000113_A01.
(408 letters)

Database: uniprot_sprot.fasta
412,525 sequences; 148,809,765 total letters

Searching..................................................done



Score E
Sequences producing significant alignments: (bits) Value

sp|P38781|RSC30_YEAST Chromatin structure-remodeling complex pro... 33 0.45
sp|Q12955|ANK3_HUMAN Ankyrin-3 OS=Homo sapiens GN=ANK3 PE=1 SV=2 30 2.9
sp|A6SUH6|TRPD_JANMA Anthranilate phosphoribosyltransferase OS=J... 30 3.8
sp|Q54NC6|APC1_DICDI Anaphase-promoting complex subunit 1 OS=Dic... 30 3.8
sp|Q3APY5|SYL_CHLCH Leucyl-tRNA synthetase OS=Chlorobium chloroc... 30 4.8
sp|Q55CX9|IPO7_DICDI Probable importin-7 homolog OS=Dictyosteliu... 29 6.3
sp|Q030E7|SYL_LACLS Leucyl-tRNA synthetase OS=Lactococcus lactis... 29 8.2
sp|A2RLY6|SYL_LACLM Leucyl-tRNA synthetase OS=Lactococcus lactis... 29 8.2
sp|Q9CHB6|SYL_LACLA Leucyl-tRNA synthetase OS=Lactococcus lactis... 29 8.2

>sp|P38781|RSC30_YEAST Chromatin structure-remodeling complex
protein RSC30 OS=Saccharomyces cerevisiae GN=RSC30 PE=1
SV=2
Length = 883

Score = 33.1 bits (74), Expect = 0.45
Identities = 19/44 (43%), Positives = 23/44 (52%)
Frame = +1

Query: 40 MGWTGACIESCNNANNTTAARQESEGSETFTSRVNNNAIIFAGS 171
M WT A NN NN TA RQ S T +S V+ N I+ + S
Sbjct: 112 MQWTKAASYQNNNTNNNTAPRQ---NSSTVSSNVHGNTIVRSDS 152


>sp|Q12955|ANK3_HUMAN Ankyrin-3 OS=Homo sapiens GN=ANK3 PE=1 SV=2
Length = 4372

Score = 30.4 bits (67), Expect = 2.9
Identities = 16/47 (34%), Positives = 30/47 (63%)
Frame = +1

Query: 220 LPFTKLLSSFAVPILFAALTSTLSPLQSSKHLQNSVLFPTSFSLSNP 360
LPF +++S A P++ + L S +SP++S+ + +S + SLS+P
Sbjct: 1653 LPFKSIITS-AAPLISSPLKSVVSPVKSAVDVISSAKITMASSLSSP 1698


>sp|A6SUH6|TRPD_JANMA Anthranilate phosphoribosyltransferase
OS=Janthinobacterium sp. (strain Marseille) GN=trpD PE=3
SV=1
Length = 344

Score = 30.0 bits (66), Expect = 3.8
Identities = 16/37 (43%), Positives = 23/37 (62%)
Frame = +1

Query: 178 MQHQAKFLEEMLHLLPFTKLLSSFAVPILFAALTSTL 288
+ H+ F +EMLHL F K++S P++ AALT L
Sbjct: 13 IDHREIFHDEMLHL--FRKIMSGEMSPVMIAALTMGL 47


>sp|Q54NC6|APC1_DICDI Anaphase-promoting complex subunit 1
OS=Dictyostelium discoideum GN=anapc1 PE=3 SV=1
Length = 2269

Score = 30.0 bits (66), Expect = 3.8
Identities = 30/106 (28%), Positives = 44/106 (41%), Gaps = 4/106 (3%)
Frame = +1

Query: 73 NNANNTTAARQESEGSETFTSRVNNNAIIFAGSVLMQHQAKFLEEMLHLLPFTKLLSSFA 252
NN NN + + + NNN ++L H FL+ + LP+T+ F
Sbjct: 1963 NNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNKNILKNHPTIFLKRKIGHLPYTEDPEGFR 2022

Query: 253 VPILFAALTSTLSPLQSSKHLQ-NSVLFPTSFSLSNPR---*AKHF 378
+ ++S SSK Q N F SF +S+P AKHF
Sbjct: 2023 SLSKSFPKSESISLYSSSKGFQKNKEEFLKSF-ISDPNLLAFAKHF 2067


>sp|Q3APY5|SYL_CHLCH Leucyl-tRNA synthetase OS=Chlorobium
chlorochromatii (strain CaD3) GN=leuS PE=3 SV=1
Length = 805

Score = 29.6 bits (65), Expect = 4.8
Identities = 17/54 (31%), Positives = 26/54 (48%), Gaps = 9/54 (16%)
Frame = -3

Query: 388 TCLRSA---LLIEGLKVKMKLERAQSFEDALKIAKEK------EWKLKRQREWG 254
TC+ SA + + GL ER ++ ++ K+ K K +W RQR WG
Sbjct: 375 TCVNSANDEISLNGLDFATAFERMATWLESKKVGKRKVNYKLRDWIFSRQRYWG 428


>sp|Q55CX9|IPO7_DICDI Probable importin-7 homolog OS=Dictyostelium
discoideum GN=DDB_G0269860 PE=3 SV=1
Length = 1065

Score = 29.3 bits (64), Expect = 6.3
Identities = 14/43 (32%), Positives = 27/43 (62%)
Frame = -3

Query: 388 TCLRSALLIEGLKVKMKLERAQSFEDALKIAKEKEWKLKRQRE 260
TC++ + K+K + A + ++ L++ KEKE KLK+Q++
Sbjct: 1021 TCIQQISEKQQEKIKKYVASAPARKEKLRLEKEKEEKLKQQQQ 1063


>sp|Q030E7|SYL_LACLS Leucyl-tRNA synthetase OS=Lactococcus lactis
subsp. cremoris (strain SK11) GN=leuS PE=3 SV=1
Length = 829

Score = 28.9 bits (63), Expect = 8.2
Identities = 15/43 (34%), Positives = 21/43 (48%), Gaps = 6/43 (13%)
Frame = -3

Query: 364 IEGLKVKMKLERAQSFEDALKIAKEK------EWKLKRQREWG 254
+ GL +E+A F + KI K+K +W RQR WG
Sbjct: 383 LNGLDKAQAIEKAIEFLEEKKIGKKKITYRLRDWLFSRQRYWG 425


>sp|A2RLY6|SYL_LACLM Leucyl-tRNA synthetase OS=Lactococcus lactis
subsp. cremoris (strain MG1363) GN=leuS PE=3 SV=1
Length = 829

Score = 28.9 bits (63), Expect = 8.2
Identities = 15/43 (34%), Positives = 21/43 (48%), Gaps = 6/43 (13%)
Frame = -3

Query: 364 IEGLKVKMKLERAQSFEDALKIAKEK------EWKLKRQREWG 254
+ GL +E+A F + KI K+K +W RQR WG
Sbjct: 383 LNGLDKAQAIEKAIEFLEEKKIGKKKITYRLRDWLFSRQRYWG 425


>sp|Q9CHB6|SYL_LACLA Leucyl-tRNA synthetase OS=Lactococcus lactis
subsp. lactis GN=leuS PE=3 SV=1
Length = 829

Score = 28.9 bits (63), Expect = 8.2
Identities = 15/43 (34%), Positives = 21/43 (48%), Gaps = 6/43 (13%)
Frame = -3

Query: 364 IEGLKVKMKLERAQSFEDALKIAKEK------EWKLKRQREWG 254
+ GL +E+A F + KI K+K +W RQR WG
Sbjct: 383 LNGLDKAQAIEKAIEFLEEKKIGKKKITYRLRDWLFSRQRYWG 425


tr_hit_id A6L2U7
Definition tr|A6L2U7|A6L2U7_BACV8 ABC transporter permease OS=Bacteroides vulgatus (strain ATCC 8482 / DSM 1447 / NCTC 11154)
Align length 49
Score (bit) 33.5
E-value 5.5
Report
BLASTX 2.2.19 [Nov-02-2008]


Reference: Altschul, Stephen F., Thomas L. Madden, Alejandro A. Schaffer,
Jinghui Zhang, Zheng Zhang, Webb Miller, and David J. Lipman (1997),
"Gapped BLAST and PSI-BLAST: a new generation of protein database search
programs", Nucleic Acids Res. 25:3389-3402.

Query= BP918391|Adiantum capillus-veneris mRNA, clone:
YMU001_000113_A01.
(408 letters)

Database: uniprot_trembl.fasta
7,341,751 sequences; 2,391,615,440 total letters

Searching..................................................done



Score E
Sequences producing significant alignments: (bits) Value

tr|A6L2U7|A6L2U7_BACV8 ABC transporter permease OS=Bacteroides v... 33 5.5
tr|B6W211|B6W211_9BACE Putative uncharacterized protein OS=Bacte... 33 5.5
tr|A7NL17|A7NL17_ROSCS Putative uncharacterized protein OS=Rosei... 33 7.1
tr|B7BUU9|B7BUU9_9FIRM Putative uncharacterized protein (Fragmen... 33 7.1
tr|B3LSH5|B3LSH5_YEAS1 Chromatin structure remodeling complex pr... 33 7.1
tr|A6ZSW2|A6ZSW2_YEAS7 RSC complex subunit OS=Saccharomyces cere... 33 7.1
tr|B0CZG5|B0CZG5_LACBS Predicted protein OS=Laccaria bicolor (st... 33 9.3

>tr|A6L2U7|A6L2U7_BACV8 ABC transporter permease OS=Bacteroides
vulgatus (strain ATCC 8482 / DSM 1447 / NCTC 11154)
GN=BVU_2352 PE=4 SV=1
Length = 414

Score = 33.5 bits (75), Expect = 5.5
Identities = 17/49 (34%), Positives = 30/49 (61%), Gaps = 3/49 (6%)
Frame = +1

Query: 85 NTTAARQESEGSET---FTSRVNNNAIIFAGSVLMQHQAKFLEEMLHLL 222
N A ++S+G +T F ++N ++ SVLM H A++LE++ HL+
Sbjct: 39 NYEVAARQSKGYDTENVFDIQLNIKPVLQNDSVLMSHSAEYLEQIYHLI 87


>tr|B6W211|B6W211_9BACE Putative uncharacterized protein
OS=Bacteroides dorei DSM 17855 GN=BACDOR_03665 PE=4 SV=1
Length = 414

Score = 33.5 bits (75), Expect = 5.5
Identities = 18/49 (36%), Positives = 30/49 (61%), Gaps = 3/49 (6%)
Frame = +1

Query: 85 NTTAARQESEGSET---FTSRVNNNAIIFAGSVLMQHQAKFLEEMLHLL 222
N AA ++S+G +T F ++N + SVLM H A++LE++ HL+
Sbjct: 39 NYEAAARQSKGYDTENVFDIQLNIKPALQNDSVLMSHSAEYLEQIYHLI 87


>tr|A7NL17|A7NL17_ROSCS Putative uncharacterized protein
OS=Roseiflexus castenholzii (strain DSM 13941 / HLO8)
GN=Rcas_2101 PE=4 SV=1
Length = 646

Score = 33.1 bits (74), Expect = 7.1
Identities = 19/67 (28%), Positives = 31/67 (46%)
Frame = +1

Query: 154 IIFAGSVLMQHQAKFLEEMLHLLPFTKLLSSFAVPILFAALTSTLSPLQSSKHLQNSVLF 333
++F G VL Q + EE LH+L + L VP + L L +HL+
Sbjct: 55 VVFGGDVLTQQVQR--EETLHILLRAQWLGIVGVPAGYIHLADALLDFSGQRHLRRRWSV 112

Query: 334 PTSFSLS 354
P ++++S
Sbjct: 113 PVAYAIS 119


>tr|B7BUU9|B7BUU9_9FIRM Putative uncharacterized protein (Fragment)
OS=Roseburia intestinalis L1-82 GN=ROSINTL182_00526 PE=4
SV=1
Length = 235

Score = 33.1 bits (74), Expect = 7.1
Identities = 19/56 (33%), Positives = 30/56 (53%)
Frame = +1

Query: 16 LLRDKKSEMGWTGACIESCNNANNTTAARQESEGSETFTSRVNNNAIIFAGSVLMQ 183
L+ + ++ +TG ES N A TA ES+G TSR+ ++AI+ + L Q
Sbjct: 58 LINARTEDIYFTGGGSESDNWALKATAEAYESKGKHIITSRIEHHAILHTCAYLEQ 113


>tr|B3LSH5|B3LSH5_YEAS1 Chromatin structure remodeling complex
protein RSC30 OS=Saccharomyces cerevisiae (strain
RM11-1a) GN=SCRG_04767 PE=4 SV=1
Length = 883

Score = 33.1 bits (74), Expect = 7.1
Identities = 19/44 (43%), Positives = 23/44 (52%)
Frame = +1

Query: 40 MGWTGACIESCNNANNTTAARQESEGSETFTSRVNNNAIIFAGS 171
M WT A NN NN TA RQ S T +S V+ N I+ + S
Sbjct: 112 MQWTKAASYQNNNTNNNTAPRQ---NSSTVSSNVHGNTIVRSDS 152


>tr|A6ZSW2|A6ZSW2_YEAS7 RSC complex subunit OS=Saccharomyces
cerevisiae (strain YJM789) GN=RSC30 PE=4 SV=1
Length = 883

Score = 33.1 bits (74), Expect = 7.1
Identities = 19/44 (43%), Positives = 23/44 (52%)
Frame = +1

Query: 40 MGWTGACIESCNNANNTTAARQESEGSETFTSRVNNNAIIFAGS 171
M WT A NN NN TA RQ S T +S V+ N I+ + S
Sbjct: 112 MQWTKAASYQNNNTNNNTAPRQ---NSSTVSSNVHGNTIVRSDS 152


>tr|B0CZG5|B0CZG5_LACBS Predicted protein OS=Laccaria bicolor (strain
S238N-H82) GN=LACBIDRAFT_323208 PE=4 SV=1
Length = 2101

Score = 32.7 bits (73), Expect = 9.3
Identities = 19/44 (43%), Positives = 25/44 (56%)
Frame = +1

Query: 175 LMQHQAKFLEEMLHLLPFTKLLSSFAVPILFAALTSTLSPLQSS 306
+++H LEE PF L S A +LF A TST++PL SS
Sbjct: 941 VLEHAPPLLEER----PFATLSQSVADALLFKATTSTINPLVSS 980