BP918403
Clone id YMU001_000113_B03
Library
Length 531
Definition Adiantum capillus-veneris mRNA. clone: YMU001_000113_B03.
Accession
Tissue type prothallium
Developmental stage -
Contig ID -
Sequence
CTCCTCCCTCCTCTCTCCCTCTCCAAATTGATGTTCCGTCGCTTGTCCATCTGATCATAA
ACTGGCAACCTCTGAAACAACCATGTTGCCCAATTGAGTGCCACATTCCTCTCCGCATTG
AGAAAAGGTTGGAAAGCATCTGTGCTCATGTATGTTGTCTTCTCGATGATACATACTCTA
TCCAAGTACCACTTCACATGCCAATGTTGCAACAGATCGGCGCGAGGGCGCCCCAAACAT
GAGTTGATCTATAATCCTCACCATCGCCCTCGCCCTGTTGTAGCATCCCAAAGACCTCCT
CAGCATTTGTAGCCGCTCCCCAAACCTTCCATGGTCTATTCGCAAAGTCCCACAGCCCAA
TCTTTTTCAGCCAAGCCGCTGTGCTAGGATTCCCAAATCAATTTGTGCTTCAACATGAGT
GCTCTAAGGCTCCTCCCCTCCTTCATCAACATCAATCACATGAGCTGTAACAGCCGCCTG
CGCAATTCCCATCTTTGCCTTAGCCTCCTCTTTTGACTTCCGTGGATTGAG
■■Homology search results ■■ -
sp_hit_id O83485
Definition sp|O83485|UVRC_TREPA UvrABC system protein C OS=Treponema pallidum
Align length 35
Score (bit) 30.8
E-value 4.3
Report
BLASTX 2.2.19 [Nov-02-2008]


Reference: Altschul, Stephen F., Thomas L. Madden, Alejandro A. Schaffer,
Jinghui Zhang, Zheng Zhang, Webb Miller, and David J. Lipman (1997),
"Gapped BLAST and PSI-BLAST: a new generation of protein database search
programs", Nucleic Acids Res. 25:3389-3402.

Query= BP918403|Adiantum capillus-veneris mRNA, clone:
YMU001_000113_B03.
(531 letters)

Database: uniprot_sprot.fasta
412,525 sequences; 148,809,765 total letters

Searching..................................................done



Score E
Sequences producing significant alignments: (bits) Value

sp|O83485|UVRC_TREPA UvrABC system protein C OS=Treponema pallid... 31 4.3
sp|P06599|EXTN_DAUCA Extensin OS=Daucus carota PE=2 SV=1 31 4.3
sp|O35485|VEGFB_RAT Vascular endothelial growth factor B OS=Ratt... 30 5.6
sp|Q9LK32|Y3721_ARATH Uncharacterized protein At3g27210 OS=Arabi... 30 7.3
sp|P49766|VEGFB_MOUSE Vascular endothelial growth factor B OS=Mu... 30 7.3
sp|Q5KHY3|NST1_CRYNE Stress response protein NST1 OS=Cryptococcu... 30 7.3
sp|P97879|GRIP1_RAT Glutamate receptor-interacting protein 1 OS=... 30 7.3
sp|O04532|FH8_ARATH Formin-like protein 8 OS=Arabidopsis thalian... 30 7.3
sp|Q09575|YRD6_CAEEL Uncharacterized protein K02A2.6 OS=Caenorha... 30 9.4
sp|Q2UXR0|VM1_ECHOC Zinc metalloproteinase-disintegrin Eoc1 OS=E... 30 9.4

>sp|O83485|UVRC_TREPA UvrABC system protein C OS=Treponema pallidum
GN=uvrC PE=3 SV=1
Length = 691

Score = 30.8 bits (68), Expect = 4.3
Identities = 14/35 (40%), Positives = 17/35 (48%)
Frame = +1

Query: 163 SMIHTLSKYHFTCQCCNRSARGRPKHELIYNPHHR 267
S +HTL K H C + P HE + PHHR
Sbjct: 381 STMHTLQKAHDACTASEGTRENTP-HESAHTPHHR 414


>sp|P06599|EXTN_DAUCA Extensin OS=Daucus carota PE=2 SV=1
Length = 306

Score = 30.8 bits (68), Expect = 4.3
Identities = 15/40 (37%), Positives = 16/40 (40%)
Frame = +1

Query: 232 PKHELIYNPHHRPRPVVASQRPPQHL*PLPKPSMVYSQSP 351
P H Y P PV S PP+H P P P Y P
Sbjct: 217 PVHHYKYKSPPPPTPVYKSPPPPEHSPPPPTPVYKYKSPP 256


>sp|O35485|VEGFB_RAT Vascular endothelial growth factor B OS=Rattus
norvegicus GN=Vegfb PE=2 SV=3
Length = 207

Score = 30.4 bits (67), Expect = 5.6
Identities = 17/66 (25%), Positives = 26/66 (39%), Gaps = 8/66 (12%)
Frame = +1

Query: 190 HFTCQCCNRSARGRPKHELIYNPHHRPRP--------VVASQRPPQHL*PLPKPSMVYSQ 345
H C+C + K + + PHHRP+P + P + P P P
Sbjct: 119 HSQCECRPKRKESAVKPDRVAIPHHRPQPRSVLSWDSAPGASSPADIIHPTPAPGPSAHA 178

Query: 346 SPTAQS 363
+P+A S
Sbjct: 179 APSAVS 184


>sp|Q9LK32|Y3721_ARATH Uncharacterized protein At3g27210
OS=Arabidopsis thaliana GN=Y-2 PE=1 SV=1
Length = 234

Score = 30.0 bits (66), Expect = 7.3
Identities = 10/18 (55%), Positives = 12/18 (66%)
Frame = -1

Query: 165 REDNIHEHRCFPTFSQCG 112
++ N H HRC P FS CG
Sbjct: 197 KKSNWHHHRCLPGFSSCG 214


>sp|P49766|VEGFB_MOUSE Vascular endothelial growth factor B OS=Mus
musculus GN=Vegfb PE=1 SV=2
Length = 207

Score = 30.0 bits (66), Expect = 7.3
Identities = 16/64 (25%), Positives = 25/64 (39%), Gaps = 8/64 (12%)
Frame = +1

Query: 190 HFTCQCCNRSARGRPKHELIYNPHHRPRP--------VVASQRPPQHL*PLPKPSMVYSQ 345
H C+C + K + + PHHRP+P + P + P P P
Sbjct: 119 HSQCECRPKKKESAVKPDRVAIPHHRPQPRSVPGWDSTPGASSPADIIHPTPAPGSSARL 178

Query: 346 SPTA 357
+P+A
Sbjct: 179 APSA 182


>sp|Q5KHY3|NST1_CRYNE Stress response protein NST1 OS=Cryptococcus
neoformans GN=NST1 PE=3 SV=1
Length = 1353

Score = 30.0 bits (66), Expect = 7.3
Identities = 17/39 (43%), Positives = 24/39 (61%)
Frame = +1

Query: 256 PHHRPRPVVASQRPPQHL*PLPKPSMVYSQSPTAQSFSA 372
P H+P+P+ SQ+PP L PLP P+ + +PT S A
Sbjct: 318 PTHQPQPL--SQQPPS-LNPLPPPAPASAPTPTPPSSRA 353


>sp|P97879|GRIP1_RAT Glutamate receptor-interacting protein 1
OS=Rattus norvegicus GN=Grip1 PE=1 SV=1
Length = 1112

Score = 30.0 bits (66), Expect = 7.3
Identities = 16/38 (42%), Positives = 21/38 (55%)
Frame = +1

Query: 250 YNPHHRPRPVVASQRPPQHL*PLPKPSMVYSQSPTAQS 363
+NPHH V + P+ L P P+MV S SPT+ S
Sbjct: 375 HNPHHPDHCRVPALGFPKALTPNSPPAMVSSSSPTSMS 412


>sp|O04532|FH8_ARATH Formin-like protein 8 OS=Arabidopsis thaliana
GN=FH8 PE=2 SV=1
Length = 760

Score = 30.0 bits (66), Expect = 7.3
Identities = 16/47 (34%), Positives = 20/47 (42%)
Frame = +1

Query: 223 RGRPKHELIYNPHHRPRPVVASQRPPQHL*PLPKPSMVYSQSPTAQS 363
R H +I+N H+P P V P P P PS+ QS S
Sbjct: 212 RSSTSHSVIHNEDHQPPPQVKQSEPTP---PPPPPSIAVKQSAPTPS 255


>sp|Q09575|YRD6_CAEEL Uncharacterized protein K02A2.6
OS=Caenorhabditis elegans GN=K02A2.6 PE=2 SV=1
Length = 1268

Score = 29.6 bits (65), Expect = 9.4
Identities = 24/65 (36%), Positives = 35/65 (53%), Gaps = 2/65 (3%)
Frame = +3

Query: 30 DVPSLVHLIIN--WQPLKQPCCPIECHIPLRIEKRLESICAHVCCLLDDTYSIQVPLHMP 203
+V S+V L+ N W+P +P IE H +R RL+ I H C LLDD + L
Sbjct: 731 EVSSVVKLVRNDSWKP--KPSTEIEKHW-IRYRDRLKLI--HGCLLLDDRVIVPKSLQKI 785

Query: 204 MLQQI 218
+L+Q+
Sbjct: 786 VLKQL 790


>sp|Q2UXR0|VM1_ECHOC Zinc metalloproteinase-disintegrin Eoc1
OS=Echis ocellatus PE=2 SV=1
Length = 614

Score = 29.6 bits (65), Expect = 9.4
Identities = 14/38 (36%), Positives = 21/38 (55%)
Frame = +2

Query: 302 SICSRSPNLPWSIRKVPQPNLFQPSRCARIPKSICAST 415
S CSR N + I K+PQ L +PSR + +C ++
Sbjct: 375 SNCSREENRRYLINKMPQCILIKPSRTDIVSPPVCGNS 412


tr_hit_id A7SYC3
Definition tr|A7SYC3|A7SYC3_NEMVE Predicted protein OS=Nematostella vectensis
Align length 35
Score (bit) 36.6
E-value 0.81
Report
BLASTX 2.2.19 [Nov-02-2008]


Reference: Altschul, Stephen F., Thomas L. Madden, Alejandro A. Schaffer,
Jinghui Zhang, Zheng Zhang, Webb Miller, and David J. Lipman (1997),
"Gapped BLAST and PSI-BLAST: a new generation of protein database search
programs", Nucleic Acids Res. 25:3389-3402.

Query= BP918403|Adiantum capillus-veneris mRNA, clone:
YMU001_000113_B03.
(531 letters)

Database: uniprot_trembl.fasta
7,341,751 sequences; 2,391,615,440 total letters

Searching..................................................done



Score E
Sequences producing significant alignments: (bits) Value

tr|A7SYC3|A7SYC3_NEMVE Predicted protein OS=Nematostella vectens... 37 0.81
tr|Q5KL97|Q5KL97_CRYNE Putative uncharacterized protein OS=Crypt... 35 3.2
tr|A6T9U4|A6T9U4_KLEP7 Putative protease OS=Klebsiella pneumonia... 34 5.4
tr|B4MTT6|B4MTT6_DROWI GK23900 OS=Drosophila willistoni GN=GK239... 34 5.4
tr|A7T3H7|A7T3H7_NEMVE Predicted protein (Fragment) OS=Nematoste... 34 5.4
tr|B1Z247|B1Z247_BURA4 Xanthine permease OS=Burkholderia ambifar... 33 7.0
tr|B1FK40|B1FK40_9BURK Xanthine permease OS=Burkholderia ambifar... 33 7.0
tr|B0LK19|B0LK19_CUCSA Zinc finger-homeodomain protein 1 (Fragme... 33 7.0
tr|Q0D1Q3|Q0D1Q3_ASPTN Putative uncharacterized protein OS=Asper... 33 9.0
tr|Q0BA61|Q0BA61_BURCM Uracil-xanthine permease OS=Burkholderia ... 33 9.2
tr|B7KJZ7|B7KJZ7_9CHRO Putative uncharacterized protein OS=Cyano... 33 9.2
tr|B1T3B3|B1T3B3_9BURK Xanthine permease OS=Burkholderia ambifar... 33 9.2

>tr|A7SYC3|A7SYC3_NEMVE Predicted protein OS=Nematostella vectensis
GN=v1g137777 PE=4 SV=1
Length = 169

Score = 36.6 bits (83), Expect = 0.81
Identities = 15/35 (42%), Positives = 19/35 (54%)
Frame = -3

Query: 385 STAAWLKKIGLWDFANRPWKVWGAATNAEEVFGML 281
S W + +WD R WKVWG T +V+GML
Sbjct: 121 SMGMWTRYGKVWDMVTRYWKVWGMVTRYWKVWGML 155



Score = 35.4 bits (80), Expect = 1.8
Identities = 19/45 (42%), Positives = 24/45 (53%), Gaps = 1/45 (2%)
Frame = -3

Query: 355 LWDFANRPWKVWGAATNAEEVFGML-QQGEGDGEDYRSTHVWGAL 224
+WD R WKVWG T +V+GML + G+ R VWG L
Sbjct: 8 VWDMVTRYWKVWGMVTRYWKVWGMLTRYGKVWDMLTRYGKVWGML 52


>tr|Q5KL97|Q5KL97_CRYNE Putative uncharacterized protein
OS=Cryptococcus neoformans GN=CNBC6970 PE=4 SV=1
Length = 1033

Score = 34.7 bits (78), Expect = 3.2
Identities = 23/60 (38%), Positives = 32/60 (53%), Gaps = 5/60 (8%)
Frame = +1

Query: 181 SKYHFTC-QCCNRSARGRPKHELIYNPHHRPRPVVAS---QRP-PQHL*PLPKPSMVYSQ 345
SK FTC +C R+A R + E + + + RP PV+ S RP P H P P+P + Q
Sbjct: 776 SKVDFTCKECQQRAANKRLRIESLTHANSRPIPVIPSPLAPRPTPPHPYPHPRPHSAHQQ 835


>tr|A6T9U4|A6T9U4_KLEP7 Putative protease OS=Klebsiella pneumoniae
subsp. pneumoniae (strain ATCC 700721 / MGH 78578)
GN=ydcP PE=4 SV=1
Length = 653

Score = 33.9 bits (76), Expect = 5.4
Identities = 21/67 (31%), Positives = 32/67 (47%)
Frame = +1

Query: 124 KGWKASVLMYVVFSMIHTLSKYHFTCQCCNRSARGRPKHELIYNPHHRPRPVVASQRPPQ 303
K WKA+ + + + TL F C+ C G+ K+ ++ PH P +VAS P
Sbjct: 588 KSWKATPMQLIHGDEVLTLK---FDCRPCEMHVVGKIKNHILKMPH--PGSIVASVSPDD 642

Query: 304 HL*PLPK 324
+ LPK
Sbjct: 643 LMKTLPK 649


>tr|B4MTT6|B4MTT6_DROWI GK23900 OS=Drosophila willistoni GN=GK23900
PE=4 SV=1
Length = 80

Score = 33.9 bits (76), Expect = 5.4
Identities = 15/31 (48%), Positives = 19/31 (61%)
Frame = +1

Query: 259 HHRPRPVVASQRPPQHL*PLPKPSMVYSQSP 351
HH P PVV Q+PP P P++VY Q+P
Sbjct: 28 HHHPPPVVVVQQPPP-----PPPTVVYQQAP 53


>tr|A7T3H7|A7T3H7_NEMVE Predicted protein (Fragment) OS=Nematostella
vectensis GN=v1g144336 PE=4 SV=1
Length = 230

Score = 33.9 bits (76), Expect = 5.4
Identities = 29/111 (26%), Positives = 44/111 (39%), Gaps = 4/111 (3%)
Frame = +1

Query: 172 HTLSKYHFTCQCCNRSARGRPKHELIYNPHHRPRPVVASQRPPQHL*PLPKPSMVYSQSP 351
H LSK+H C C S RP + + HHRPR S + QH +P + P
Sbjct: 39 HVLSKHHRPCSCQVLSKHHRPCSCQVSSKHHRPRSCHVSSK--QH-----RPCSCHVSCP 91

Query: 352 TAQSFSAKPLC*D----SQINLCFNMSALRLLPSFININHMSCNSRLRNSH 492
+A + S + C N + L + S N C+ ++ + H
Sbjct: 92 NTTGLAAVMSRLNTTGLSAVRSCLNTTGLAAVSSKHN---RPCSCQVSSKH 139


>tr|B1Z247|B1Z247_BURA4 Xanthine permease OS=Burkholderia ambifaria
(strain MC40-6) GN=BamMC406_3915 PE=4 SV=1
Length = 462

Score = 33.5 bits (75), Expect = 7.0
Identities = 17/48 (35%), Positives = 26/48 (54%), Gaps = 4/48 (8%)
Frame = +1

Query: 217 SARGRPKHELIYNPHHRPRPVVASQRPPQHL----*PLPKPSMVYSQS 348
+A P H+L+Y P+ RP P+VA QHL P+ P ++ Q+
Sbjct: 14 AADADPSHDLVYGPNDRPAPMVAFVAALQHLLAIIVPIVTPGLLICQA 61


>tr|B1FK40|B1FK40_9BURK Xanthine permease OS=Burkholderia ambifaria
IOP40-10 GN=BamIOP4010DRAFT_4401 PE=4 SV=1
Length = 462

Score = 33.5 bits (75), Expect = 7.0
Identities = 17/48 (35%), Positives = 26/48 (54%), Gaps = 4/48 (8%)
Frame = +1

Query: 217 SARGRPKHELIYNPHHRPRPVVASQRPPQHL----*PLPKPSMVYSQS 348
+A P H+L+Y P+ RP P+VA QHL P+ P ++ Q+
Sbjct: 14 AADADPSHDLVYGPNDRPAPMVAFVAALQHLLAIIVPIVTPGLLICQA 61


>tr|B0LK19|B0LK19_CUCSA Zinc finger-homeodomain protein 1 (Fragment)
OS=Cucumis sativus GN=ZHD1 PE=2 SV=1
Length = 302

Score = 33.5 bits (75), Expect = 7.0
Identities = 17/43 (39%), Positives = 20/43 (46%), Gaps = 3/43 (6%)
Frame = +1

Query: 232 PKHELIYNPHHR---PRPVVASQRPPQHL*PLPKPSMVYSQSP 351
P H + Y PHHR P P +A R P P P S Y +P
Sbjct: 119 PTHVIEYQPHHRHHPPPPPLAGNRSPNSASPPPISSSYYPSAP 161


>tr|Q0D1Q3|Q0D1Q3_ASPTN Putative uncharacterized protein
OS=Aspergillus terreus (strain NIH 2624) GN=ATEG_00131
PE=4 SV=1
Length = 282

Score = 33.1 bits (74), Expect = 9.0
Identities = 19/67 (28%), Positives = 31/67 (46%), Gaps = 4/67 (5%)
Frame = +3

Query: 48 HLIINWQPLKQPCCPIECHIPLRIEKRLESICAHVCC----LLDDTYSIQVPLHMPMLQQ 215
H+ + W P KQ E + + +LE IC+ C LL +Q+PLH+ + +
Sbjct: 65 HIYLEWYPSKQ-----ELRVLEDVVSQLEGICSKSCVKIHSLLRSDLGVQLPLHISLSRP 119

Query: 216 IGARAPQ 236
+ R Q
Sbjct: 120 VVLRTEQ 126


>tr|Q0BA61|Q0BA61_BURCM Uracil-xanthine permease OS=Burkholderia
ambifaria (strain ATCC BAA-244 / AMMD) GN=Bamb_3408 PE=4
SV=1
Length = 462

Score = 33.1 bits (74), Expect = 9.2
Identities = 16/43 (37%), Positives = 24/43 (55%), Gaps = 4/43 (9%)
Frame = +1

Query: 232 PKHELIYNPHHRPRPVVASQRPPQHL----*PLPKPSMVYSQS 348
P H+L+Y P+ RP P+VA QHL P+ P ++ Q+
Sbjct: 19 PSHDLVYGPNDRPAPMVAFVAALQHLLAIIVPIVTPGLLICQA 61