BP918438
Clone id YMU001_000113_E05
Library
Length 620
Definition Adiantum capillus-veneris mRNA. clone: YMU001_000113_E05.
Accession
Tissue type prothallium
Developmental stage -
Contig ID -
Sequence
CCCCATATGCCTTACAGGCAGTGAGTAAAGAGACCCATCCAGCTACATCACCAGAAGCGG
GCATCGACTGAAGAATCTTCTCAGCTTCTTTTAAACAACCAGATCGGCTAAGAAGCTCAG
ACAAACAGTTGACATGCTCCACTGTTGGAACTATCCCATGATTGATCATGTTTTCAAAGT
GCTGGAAGCCTTCATCAACATGGCATGCATGGCTACAGGCCATAAAAAGAGTGACATAAA
TCTTTCCATCTGGTTGTAAACCTCTCTTCTCCAACTCTTTCATGCACTTTAGAGCATCGG
ATATTTTCCCTTGCTGTGCATACCCTACAATTAATGCAGTCCATGACACCACATGGGGAT
TTGCCAGTCTATTGAAAACATTGCTAGCTTCATCCAAACTTCCAAACTTTGAATACATGT
CGACCAGGGTGGTGCCAACTAAAATATCCGACTCAAAGGCATCCCTCACTATCAGTTCAT
GAATTAACTTACCTTGCTCAAAAGCTCCCATGCTGCCACAGGCCATTGCACATGACAGCA
ATGTAACCTTGTCTGCTTTCATGCCTCTCGACTGCATCAACTCTAGAATTTCGAGCGTAT
CAAGCCTCTTTCATTTTCCA
■■Homology search results ■■ -
sp_hit_id Q9SS60
Definition sp|Q9SS60|PP210_ARATH Pentatricopeptide repeat-containing protein At3g03580 OS=Arabidopsis thaliana
Align length 199
Score (bit) 149.0
E-value 1.0e-35
Report
BLASTX 2.2.19 [Nov-02-2008]


Reference: Altschul, Stephen F., Thomas L. Madden, Alejandro A. Schaffer,
Jinghui Zhang, Zheng Zhang, Webb Miller, and David J. Lipman (1997),
"Gapped BLAST and PSI-BLAST: a new generation of protein database search
programs", Nucleic Acids Res. 25:3389-3402.

Query= BP918438|Adiantum capillus-veneris mRNA, clone:
YMU001_000113_E05.
(620 letters)

Database: uniprot_sprot.fasta
412,525 sequences; 148,809,765 total letters

Searching..................................................done



Score E
Sequences producing significant alignments: (bits) Value

sp|Q9SS60|PP210_ARATH Pentatricopeptide repeat-containing protei... 149 1e-35
sp|Q9LUJ2|PP249_ARATH Pentatricopeptide repeat-containing protei... 147 3e-35
sp|Q9FI80|PP425_ARATH Pentatricopeptide repeat-containing protei... 146 7e-35
sp|Q9FJY7|PP449_ARATH Pentatricopeptide repeat-containing protei... 143 6e-34
sp|Q9LJI9|PP260_ARATH Pentatricopeptide repeat-containing protei... 143 6e-34
sp|Q9LJJ1|PP259_ARATH Putative pentatricopeptide repeat-containi... 143 6e-34
sp|O04659|PP398_ARATH Pentatricopeptide repeat-containing protei... 143 8e-34
sp|Q9SZT8|PP354_ARATH Pentatricopeptide repeat-containing protei... 142 1e-33
sp|Q9LTV8|PP224_ARATH Pentatricopeptide repeat-containing protei... 142 2e-33
sp|O23266|PP308_ARATH Pentatricopeptide repeat-containing protei... 141 2e-33
sp|Q9MAT2|PPR10_ARATH Pentatricopeptide repeat-containing protei... 141 3e-33
sp|Q9SMZ2|PP347_ARATH Pentatricopeptide repeat-containing protei... 141 3e-33
sp|Q9SJG6|PP200_ARATH Pentatricopeptide repeat-containing protei... 141 3e-33
sp|Q9C507|PP111_ARATH Putative pentatricopeptide repeat-containi... 140 7e-33
sp|O23337|PP311_ARATH Pentatricopeptide repeat-containing protei... 139 9e-33
sp|Q9LFI1|PP280_ARATH Pentatricopeptide repeat-containing protei... 139 9e-33
sp|Q3E9N1|PP359_ARATH Pentatricopeptide repeat-containing protei... 139 2e-32
sp|P0C899|PP271_ARATH Putative pentatricopeptide repeat-containi... 139 2e-32
sp|Q8LK93|PP145_ARATH Pentatricopeptide repeat-containing protei... 138 2e-32
sp|Q9SY02|PP301_ARATH Pentatricopeptide repeat-containing protei... 138 3e-32
sp|Q9FIB2|PP373_ARATH Putative pentatricopeptide repeat-containi... 137 4e-32
sp|Q9SJZ3|PP169_ARATH Pentatricopeptide repeat-containing protei... 137 4e-32
sp|Q9C866|PPR65_ARATH Pentatricopeptide repeat-containing protei... 136 8e-32
sp|P93005|PP181_ARATH Pentatricopeptide repeat-containing protei... 136 8e-32
sp|Q3ECB8|PP128_ARATH Pentatricopeptide repeat-containing protei... 136 1e-31
sp|Q9LND4|PPR14_ARATH Pentatricopeptide repeat-containing protei... 135 1e-31
sp|Q9FND7|PP410_ARATH Putative pentatricopeptide repeat-containi... 135 2e-31
sp|O23491|PP315_ARATH Pentatricopeptide repeat-containing protei... 135 2e-31
sp|Q9LSB8|PP235_ARATH Putative pentatricopeptide repeat-containi... 135 2e-31
sp|Q9C6T2|PPR68_ARATH Pentatricopeptide repeat-containing protei... 135 2e-31

>sp|Q9SS60|PP210_ARATH Pentatricopeptide repeat-containing protein
At3g03580 OS=Arabidopsis thaliana GN=PCMP-H23 PE=2 SV=1
Length = 882

Score = 149 bits (375), Expect = 1e-35
Identities = 75/199 (37%), Positives = 115/199 (57%), Gaps = 1/199 (0%)
Frame = -2

Query: 595 LEILELMQSRGMKADKVTLLSCAMACGSMGAFEQGKLIHELIVRDAFESDILVGTTLVDM 416
L++ M+ + D T L C S+ A GK IH ++R +ES++ +G L++M
Sbjct: 494 LQVTTQMRKSEVVPDMATFLVTLPMCASLAAKRLGKEIHCCLLRFGYESELQIGNALIEM 553

Query: 415 YSKFGSLDEASNVFNRLANPHVVSWTALIVGYAQQGKISDALKCMKELEKRGLQPDGKIY 236
YSK G L+ +S VF R++ VV+WT +I Y G+ AL+ ++EK G+ PD ++
Sbjct: 554 YSKCGCLENSSRVFERMSRRDVVTWTGMIYAYGMYGEGEKALETFADMEKSGIVPDSVVF 613

Query: 235 VTLFMACSHACHVDEGFQHFENMINH-GIVPTVEHVNCLSELLSRSGCLKEAEKILQSMP 59
+ + ACSH+ VDEG FE M H I P +EH C+ +LLSRS + +AE+ +Q+MP
Sbjct: 614 IAIIYACSHSGLVDEGLACFEKMKTHYKIDPMIEHYACVVDLLSRSQKISKAEEFIQAMP 673

Query: 58 ASGDVAGWVSLLTACKAYG 2
D + W S+L AC+ G
Sbjct: 674 IKPDASIWASVLRACRTSG 692



Score = 87.0 bits (214), Expect = 7e-17
Identities = 53/186 (28%), Positives = 90/186 (48%)
Frame = -2

Query: 559 KADKVTLLSCAMACGSMGAFEQGKLIHELIVRDAFESDILVGTTLVDMYSKFGSLDEASN 380
K D +T+ S ACG + K I+ +++ F + V L+D+Y+K G + A +
Sbjct: 304 KPDLLTVSSVLRACGHLRDLSLAKYIYNYMLKAGFVLESTVRNILIDVYAKCGDMITARD 363

Query: 379 VFNRLANPHVVSWTALIVGYAQQGKISDALKCMKELEKRGLQPDGKIYVTLFMACSHACH 200
VFN + VSW ++I GY Q G + +A+K K + Q D Y+ L +
Sbjct: 364 VFNSMECKDTVSWNSIISGYIQSGDLMEAMKLFKMMMIMEEQADHITYLMLISVSTRLAD 423

Query: 199 VDEGFQHFENMINHGIVPTVEHVNCLSELLSRSGCLKEAEKILQSMPASGDVAGWVSLLT 20
+ G N I GI + N L ++ ++ G + ++ KI SM +GD W ++++
Sbjct: 424 LKFGKGLHSNGIKSGICIDLSVSNALIDMYAKCGEVGDSLKIFSSM-GTGDTVTWNTVIS 482

Query: 19 ACKAYG 2
AC +G
Sbjct: 483 ACVRFG 488



Score = 83.2 bits (204), Expect = 1e-15
Identities = 47/138 (34%), Positives = 70/138 (50%)
Frame = -2

Query: 601 DTLEILELMQSRGMKADKVTLLSCAMACGSMGAFEQGKLIHELIVRDAFESDILVGTTLV 422
+ LE ++ + DK T S AC + E G L++E I+ FESD+ VG LV
Sbjct: 89 EALEFYGKLRESKVSPDKYTFPSVIKACAGLFDAEMGDLVYEQILDMGFESDLFVGNALV 148

Query: 421 DMYSKFGSLDEASNVFNRLANPHVVSWTALIVGYAQQGKISDALKCMKELEKRGLQPDGK 242
DMYS+ G L A VF+ + +VSW +LI GY+ G +AL+ EL+ + PD
Sbjct: 149 DMYSRMGLLTRARQVFDEMPVRDLVSWNSLISGYSSHGYYEEALEIYHELKNSWIVPDSF 208

Query: 241 IYVTLFMACSHACHVDEG 188
++ A + V +G
Sbjct: 209 TVSSVLPAFGNLLVVKQG 226



Score = 75.1 bits (183), Expect = 3e-13
Identities = 42/201 (20%), Positives = 91/201 (45%)
Frame = -2

Query: 604 LDTLEILELMQSRGMKADKVTLLSCAMACGSMGAFEQGKLIHELIVRDAFESDILVGTTL 425
++ +++ ++M +AD +T L + + GK +H ++ D+ V L
Sbjct: 390 MEAMKLFKMMMIMEEQADHITYLMLISVSTRLADLKFGKGLHSNGIKSGICIDLSVSNAL 449

Query: 424 VDMYSKFGSLDEASNVFNRLANPHVVSWTALIVGYAQQGKISDALKCMKELEKRGLQPDG 245
+DMY+K G + ++ +F+ + V+W +I + G + L+ ++ K + PD
Sbjct: 450 IDMYAKCGEVGDSLKIFSSMGTGDTVTWNTVISACVRFGDFATGLQVTTQMRKSEVVPDM 509

Query: 244 KIYVTLFMACSHACHVDEGFQHFENMINHGIVPTVEHVNCLSELLSRSGCLKEAEKILQS 65
++ C+ G + ++ G ++ N L E+ S+ GCL+ + ++ +
Sbjct: 510 ATFLVTLPMCASLAAKRLGKEIHCCLLRFGYESELQIGNALIEMYSKCGCLENSSRVFER 569

Query: 64 MPASGDVAGWVSLLTACKAYG 2
M + DV W ++ A YG
Sbjct: 570 M-SRRDVVTWTGMIYAYGMYG 589



Score = 67.0 bits (162), Expect = 7e-11
Identities = 42/175 (24%), Positives = 82/175 (46%), Gaps = 1/175 (0%)
Frame = -2

Query: 523 ACGSMGAFEQGKLIHELIVRDAFESDILVGTTLVDMYSKFGSLDEASNVFNRLANP-HVV 347
A S + + IH L++ +S L+D YS F + +VF R++ +V
Sbjct: 13 ALSSSSNLNELRRIHALVISLGLDSSDFFSGKLIDKYSHFREPASSLSVFRRVSPAKNVY 72

Query: 346 SWTALIVGYAQQGKISDALKCMKELEKRGLQPDGKIYVTLFMACSHACHVDEGFQHFENM 167
W ++I +++ G +AL+ +L + + PD + ++ AC+ + G +E +
Sbjct: 73 LWNSIIRAFSKNGLFPEALEFYGKLRESKVSPDKYTFPSVIKACAGLFDAEMGDLVYEQI 132

Query: 166 INHGIVPTVEHVNCLSELLSRSGCLKEAEKILQSMPASGDVAGWVSLLTACKAYG 2
++ G + N L ++ SR G L A ++ MP D+ W SL++ ++G
Sbjct: 133 LDMGFESDLFVGNALVDMYSRMGLLTRARQVFDEMPVR-DLVSWNSLISGYSSHG 186



Score = 60.8 bits (146), Expect = 5e-09
Identities = 45/194 (23%), Positives = 86/194 (44%)
Frame = -2

Query: 601 DTLEILELMQSRGMKADKVTLLSCAMACGSMGAFEQGKLIHELIVRDAFESDILVGTTLV 422
+ LEI +++ + D T+ S A G++ +QG+ +H ++ S ++V LV
Sbjct: 190 EALEIYHELKNSWIVPDSFTVSSVLPAFGNLLVVKQGQGLHGFALKSGVNSVVVVNNGLV 249

Query: 421 DMYSKFGSLDEASNVFNRLANPHVVSWTALIVGYAQQGKISDALKCMKELEKRGLQPDGK 242
MY KF +A VF+ + VS+ +I GY + + ++++ E +PD
Sbjct: 250 AMYLKFRRPTDARRVFDEMDVRDSVSYNTMICGYLKLEMVEESVRMFLE-NLDQFKPDLL 308

Query: 241 IYVTLFMACSHACHVDEGFQHFENMINHGIVPTVEHVNCLSELLSRSGCLKEAEKILQSM 62
++ AC H + + M+ G V N L ++ ++ G + A + SM
Sbjct: 309 TVSSVLRACGHLRDLSLAKYIYNYMLKAGFVLESTVRNILIDVYAKCGDMITARDVFNSM 368

Query: 61 PASGDVAGWVSLLT 20
D W S+++
Sbjct: 369 ECK-DTVSWNSIIS 381


>sp|Q9LUJ2|PP249_ARATH Pentatricopeptide repeat-containing protein
At3g22690 OS=Arabidopsis thaliana GN=PCMP-H56 PE=2 SV=1
Length = 842

Score = 147 bits (372), Expect = 3e-35
Identities = 77/202 (38%), Positives = 121/202 (59%), Gaps = 2/202 (0%)
Frame = -2

Query: 601 DTLEILELMQSR-GMKADKVTLLSCAMACGSMGAFEQGKLIHELIVRDAFESDILVGTTL 425
+ +E+ MQS+ G+ AD VT++S A ACG +GA + K I+ I ++ + D+ +GTTL
Sbjct: 452 EAIEVFCSMQSQEGVNADGVTMMSIASACGHLGALDLAKWIYYYIEKNGIQLDVRLGTTL 511

Query: 424 VDMYSKFGSLDEASNVFNRLANPHVVSWTALIVGYAQQGKISDALKCMKELEKRGLQPDG 245
VDM+S+ G + A ++FN L N V +WTA I A G A++ ++ ++GL+PDG
Sbjct: 512 VDMFSRCGDPESAMSIFNSLTNRDVSAWTAAIGAMAMAGNAERAIELFDDMIEQGLKPDG 571

Query: 244 KIYVTLFMACSHACHVDEGFQHFENMIN-HGIVPTVEHVNCLSELLSRSGCLKEAEKILQ 68
+V ACSH V +G + F +M+ HG+ P H C+ +LL R+G L+EA ++++
Sbjct: 572 VAFVGALTACSHGGLVQQGKEIFYSMLKLHGVSPEDVHYGCMVDLLGRAGLLEEAVQLIE 631

Query: 67 SMPASGDVAGWVSLLTACKAYG 2
MP + W SLL AC+ G
Sbjct: 632 DMPMEPNDVIWNSLLAACRVQG 653



Score = 82.4 bits (202), Expect = 2e-15
Identities = 54/232 (23%), Positives = 101/232 (43%), Gaps = 32/232 (13%)
Frame = -2

Query: 601 DTLEILELMQSRGMKADKVTLLSCAMACGSMGAFEQGKLIHELIVRDAFESDILVGTTLV 422
+ L + LM G++ D++++LS +C + GK H ++R+ FES + L+
Sbjct: 320 EALGVFNLMMDSGVRPDRISMLSAISSCSQLRNILWGKSCHGYVLRNGFESWDNICNALI 379

Query: 421 DMYSKFGSLDEASNVFNRLANPHVVSWTALIVGYAQQGKISDALKCMKELEKR------- 263
DMY K D A +F+R++N VV+W +++ GY + G++ A + + + ++
Sbjct: 380 DMYMKCHRQDTAFRIFDRMSNKTVVTWNSIVAGYVENGEVDAAWETFETMPEKNIVSWNT 439

Query: 262 -------------------------GLQPDGKIYVTLFMACSHACHVDEGFQHFENMINH 158
G+ DG +++ AC H +D + + +
Sbjct: 440 IISGLVQGSLFEEAIEVFCSMQSQEGVNADGVTMMSIASACGHLGALDLAKWIYYYIEKN 499

Query: 157 GIVPTVEHVNCLSELLSRSGCLKEAEKILQSMPASGDVAGWVSLLTACKAYG 2
GI V L ++ SR G + A I S+ + DV+ W + + A G
Sbjct: 500 GIQLDVRLGTTLVDMFSRCGDPESAMSIFNSL-TNRDVSAWTAAIGAMAMAG 550



Score = 77.4 bits (189), Expect = 5e-14
Identities = 49/176 (27%), Positives = 85/176 (48%), Gaps = 1/176 (0%)
Frame = -2

Query: 577 MQSRGMKADKVTLLSCAMACGSMGAFEQGKLIHELIVRDAFESDILVGTTLVDMYSKFGS 398
M + G+ DK T AC A G IH LIV+ + D+ V +LV Y++ G
Sbjct: 125 MMNSGISPDKYTFPFGLSACAKSRAKGNGIQIHGLIVKMGYAKDLFVQNSLVHFYAECGE 184

Query: 397 LDEASNVFNRLANPHVVSWTALIVGYAQQGKISDALKC-MKELEKRGLQPDGKIYVTLFM 221
LD A VF+ ++ +VVSWT++I GYA++ DA+ + + + P+ V +
Sbjct: 185 LDSARKVFDEMSERNVVSWTSMICGYARRDFAKDAVDLFFRMVRDEEVTPNSVTMVCVIS 244

Query: 220 ACSHACHVDEGFQHFENMINHGIVPTVEHVNCLSELLSRSGCLKEAEKILQSMPAS 53
AC+ ++ G + + + N GI V+ L ++ + + A+++ AS
Sbjct: 245 ACAKLEDLETGEKVYAFIRNSGIEVNDLMVSALVDMYMKCNAIDVAKRLFDEYGAS 300



Score = 57.0 bits (136), Expect = 8e-08
Identities = 35/151 (23%), Positives = 70/151 (46%), Gaps = 11/151 (7%)
Frame = -2

Query: 580 LMQSRGMKADKVTLLSCAMACGSMGAFEQGKLIHELIVRDAFESDILVGTTLVDMYSKFG 401
+++ + + VT++ AC + E G+ ++ I E + L+ + LVDMY K
Sbjct: 226 MVRDEEVTPNSVTMVCVISACAKLEDLETGEKVYAFIRNSGIEVNDLMVSALVDMYMKCN 285

Query: 400 SLDEASNVFNRLANPHVVSWTALIVGYAQQGKISDALKCMKELEKRGLQPDGKIYVTLFM 221
++D A +F+ ++ A+ Y +QG +AL + G++PD ++
Sbjct: 286 AIDVAKRLFDEYGASNLDLCNAMASNYVRQGLTREALGVFNLMMDSGVRPDRISMLSAIS 345

Query: 220 ACSH--------ACH---VDEGFQHFENMIN 161
+CS +CH + GF+ ++N+ N
Sbjct: 346 SCSQLRNILWGKSCHGYVLRNGFESWDNICN 376



Score = 49.7 bits (117), Expect = 1e-05
Identities = 45/190 (23%), Positives = 77/190 (40%), Gaps = 4/190 (2%)
Frame = -2

Query: 580 LMQSRGMKADKVTLLSCAMACGSMGAFEQGKLIHELIVRDAFESDILVGTTLVDMYSKFG 401
L QS+ KA +L +C ++ K+ H + + ++D+ T LV + G
Sbjct: 26 LNQSKCTKATPSSLKNCK-------TIDELKMFHRSLTKQGLDNDVSTITKLVARSCELG 78

Query: 400 ---SLDEASNVF-NRLANPHVVSWTALIVGYAQQGKISDALKCMKELEKRGLQPDGKIYV 233
SL A VF N + + +LI GYA G ++A+ + G+ PD +
Sbjct: 79 TRESLSFAKEVFENSESYGTCFMYNSLIRGYASSGLCNEAILLFLRMMNSGISPDKYTFP 138

Query: 232 TLFMACSHACHVDEGFQHFENMINHGIVPTVEHVNCLSELLSRSGCLKEAEKILQSMPAS 53
AC+ + G Q ++ G + N L + G L A K+ M +
Sbjct: 139 FGLSACAKSRAKGNGIQIHGLIVKMGYAKDLFVQNSLVHFYAECGELDSARKVFDEM-SE 197

Query: 52 GDVAGWVSLL 23
+V W S++
Sbjct: 198 RNVVSWTSMI 207


>sp|Q9FI80|PP425_ARATH Pentatricopeptide repeat-containing protein
At5g48910 OS=Arabidopsis thaliana GN=PCMP-H38 PE=2 SV=1
Length = 646

Score = 146 bits (369), Expect = 7e-35
Identities = 72/201 (35%), Positives = 119/201 (59%), Gaps = 1/201 (0%)
Frame = -2

Query: 601 DTLEILELMQSRGMKADKVTLLSCAMACGSMGAFEQGKLIHELIVRDAFESDILVGTTLV 422
D +E+ M+ ++ + VTL+S A +G+ E G+ +H D ++G+ L+
Sbjct: 257 DAVEVFREMKKGDIRPNYVTLVSVLPAISRLGSLELGEWLHLYAEDSGIRIDDVLGSALI 316

Query: 421 DMYSKFGSLDEASNVFNRLANPHVVSWTALIVGYAQQGKISDALKCMKELEKRGLQPDGK 242
DMYSK G +++A +VF RL +V++W+A+I G+A G+ DA+ C ++ + G++P
Sbjct: 317 DMYSKCGIIEKAIHVFERLPRENVITWSAMINGFAIHGQAGDAIDCFCKMRQAGVRPSDV 376

Query: 241 IYVTLFMACSHACHVDEGFQHFENMIN-HGIVPTVEHVNCLSELLSRSGCLKEAEKILQS 65
Y+ L ACSH V+EG ++F M++ G+ P +EH C+ +LL RSG L EAE+ + +
Sbjct: 377 AYINLLTACSHGGLVEEGRRYFSQMVSVDGLEPRIEHYGCMVDLLGRSGLLDEAEEFILN 436

Query: 64 MPASGDVAGWVSLLTACKAYG 2
MP D W +LL AC+ G
Sbjct: 437 MPIKPDDVIWKALLGACRMQG 457



Score = 58.2 bits (139), Expect = 3e-08
Identities = 47/239 (19%), Positives = 95/239 (39%), Gaps = 45/239 (18%)
Frame = -2

Query: 583 ELMQSRGMKADKVTLLSCAMACGSMGAFEQGKLIHELIVRDAFESD-------------- 446
E+M ++ ++ T S AC G ++GK IH L ++ F D
Sbjct: 117 EMMSDEFVEPNRFTFPSVLKACAKTGKIQEGKQIHGLALKYGFGGDEFVMSNLVRMYVMC 176

Query: 445 -------------------------------ILVGTTLVDMYSKFGSLDEASNVFNRLAN 359
I++ ++D Y + G A +F+++
Sbjct: 177 GFMKDARVLFYKNIIEKDMVVMTDRRKRDGEIVLWNVMIDGYMRLGDCKAARMLFDKMRQ 236

Query: 358 PHVVSWTALIVGYAQQGKISDALKCMKELEKRGLQPDGKIYVTLFMACSHACHVDEGFQH 179
VVSW +I GY+ G DA++ +E++K ++P+ V++ A S ++ G
Sbjct: 237 RSVVSWNTMISGYSLNGFFKDAVEVFREMKKGDIRPNYVTLVSVLPAISRLGSLELGEWL 296

Query: 178 FENMINHGIVPTVEHVNCLSELLSRSGCLKEAEKILQSMPASGDVAGWVSLLTACKAYG 2
+ GI + L ++ S+ G +++A + + +P +V W +++ +G
Sbjct: 297 HLYAEDSGIRIDDVLGSALIDMYSKCGIIEKAIHVFERLPRE-NVITWSAMINGFAIHG 354



Score = 32.0 bits (71), Expect = 2.6
Identities = 28/143 (19%), Positives = 62/143 (43%), Gaps = 9/143 (6%)
Frame = -2

Query: 484 IHELIVRDAFESDILVGTTLV------DMYSKFGSLDEASNVFNRLANPHVVSWTALIVG 323
IH + ++ D L ++ D++ + LD A +FN++ + SW +I G
Sbjct: 42 IHAVFIKSGQMRDTLAAAEILRFCATSDLHHR--DLDYAHKIFNQMPQRNCFSWNTIIRG 99

Query: 322 YAQ--QGKISDALKCMKE-LEKRGLQPDGKIYVTLFMACSHACHVDEGFQHFENMINHGI 152
+++ + K A+ E + ++P+ + ++ AC+ + EG Q + +G
Sbjct: 100 FSESDEDKALIAITLFYEMMSDEFVEPNRFTFPSVLKACAKTGKIQEGKQIHGLALKYGF 159

Query: 151 VPTVEHVNCLSELLSRSGCLKEA 83
++ L + G +K+A
Sbjct: 160 GGDEFVMSNLVRMYVMCGFMKDA 182


>sp|Q9FJY7|PP449_ARATH Pentatricopeptide repeat-containing protein
At5g66520 OS=Arabidopsis thaliana GN=PCMP-H61 PE=2 SV=1
Length = 620

Score = 143 bits (361), Expect = 6e-34
Identities = 71/200 (35%), Positives = 116/200 (58%), Gaps = 1/200 (0%)
Frame = -2

Query: 601 DTLEILELMQSRGMKADKVTLLSCAMACGSMGAFEQGKLIHELIVRDAFESDILVGTTLV 422
+ L++ MQ+ ++ D V+L + AC +GA EQGK IH + + D ++G L+
Sbjct: 230 EALQLFHEMQNSDVEPDNVSLANALSACAQLGALEQGKWIHSYLNKTRIRMDSVLGCVLI 289

Query: 421 DMYSKFGSLDEASNVFNRLANPHVVSWTALIVGYAQQGKISDALKCMKELEKRGLQPDGK 242
DMY+K G ++EA VF + V +WTALI GYA G +A+ E++K G++P+
Sbjct: 290 DMYAKCGEMEEALEVFKNIKKKSVQAWTALISGYAYHGHGREAISKFMEMQKMGIKPNVI 349

Query: 241 IYVTLFMACSHACHVDEGFQHFENM-INHGIVPTVEHVNCLSELLSRSGCLKEAEKILQS 65
+ + ACS+ V+EG F +M ++ + PT+EH C+ +LL R+G L EA++ +Q
Sbjct: 350 TFTAVLTACSYTGLVEEGKLIFYSMERDYNLKPTIEHYGCIVDLLGRAGLLDEAKRFIQE 409

Query: 64 MPASGDVAGWVSLLTACKAY 5
MP + W +LL AC+ +
Sbjct: 410 MPLKPNAVIWGALLKACRIH 429



Score = 65.5 bits (158), Expect = 2e-10
Identities = 46/159 (28%), Positives = 77/159 (48%), Gaps = 2/159 (1%)
Frame = -2

Query: 544 TLLSCAMACGSMGAFEQGKLIHELIVRDAFESDILVGTTLVDMYSKFGSLDEASNVFNRL 365
T S AC ++ AFE+ IH I + +E+D+ +L++ Y+ G+ A +F+R+
Sbjct: 117 TFPSLLKACSNLSAFEETTQIHAQITKLGYENDVYAVNSLINSYAVTGNFKLAHLLFDRI 176

Query: 364 ANPHVVSWTALIVGYAQQGKISDALKCMKEL-EKRGLQPDGKIYVTLFMACSHACHVDEG 188
P VSW ++I GY + GK+ AL +++ EK + + T+ A E
Sbjct: 177 PEPDDVSWNSVIKGYVKAGKMDIALTLFRKMAEKNAIS-----WTTMISGYVQADMNKEA 231

Query: 187 FQHFENMINHGIVP-TVEHVNCLSELLSRSGCLKEAEKI 74
Q F M N + P V N LS ++ G L++ + I
Sbjct: 232 LQLFHEMQNSDVEPDNVSLANALS-ACAQLGALEQGKWI 269


>sp|Q9LJI9|PP260_ARATH Pentatricopeptide repeat-containing protein
At3g28660 OS=Arabidopsis thaliana GN=PCMP-E80 PE=2 SV=1
Length = 504

Score = 143 bits (361), Expect = 6e-34
Identities = 74/200 (37%), Positives = 117/200 (58%), Gaps = 3/200 (1%)
Frame = -2

Query: 595 LEILELMQSRGMKADKVTLLSCAMACGSMGAFEQGKLIHELIVRDAF-ESDILVGTTLVD 419
LE+ + M RG++ D+ ++ + AC +GA QGK IHE + + + ESD+ VGT LVD
Sbjct: 203 LEVFKEMLVRGIEPDEFSVTTALTACAQVGALAQGKWIHEFVKKKRWIESDVFVGTALVD 262

Query: 418 MYSKFGSLDEASNVFNRLANPHVVSWTALIVGYAQQGKISDALKCMKELEKR-GLQPDGK 242
MY+K G ++ A VF +L +V SW ALI GYA G A C+ +E+ G++PD
Sbjct: 263 MYAKCGCIETAVEVFEKLTRRNVFSWAALIGGYAAYGYAKKATTCLDRIEREDGIKPDSV 322

Query: 241 IYVTLFMACSHACHVDEGFQHFENM-INHGIVPTVEHVNCLSELLSRSGCLKEAEKILQS 65
+ + + AC+H ++EG ENM +GI P EH +C+ +L+ R+G L +A +++
Sbjct: 323 VLLGVLAACAHGGFLEEGRTMLENMEARYGITPKHEHYSCIVDLMCRAGRLDDALDLIEK 382

Query: 64 MPASGDVAGWVSLLTACKAY 5
MP + W +LL C+ +
Sbjct: 383 MPMKPLASVWGALLNGCRTH 402



Score = 70.9 bits (172), Expect = 5e-12
Identities = 52/182 (28%), Positives = 89/182 (48%), Gaps = 2/182 (1%)
Frame = -2

Query: 541 LLSCAMACGSMGAFEQGKLIHELIVRDA-FESDILVGTTLVDMYSKFGSLDEASNVFNRL 365
+++C AC F GK IH +V++ F SD V T ++ +Y + L +A VF+ +
Sbjct: 123 IVACLKAC----FFSVGKQIHCWVVKNGVFLSDGHVQTGVLRIYVEDKLLFDARKVFDEI 178

Query: 364 ANPHVVSWTALIVGYAQQGKISDALKCMKELEKRGLQPDGKIYVTLFMACSHACHVDEG- 188
P VV W L+ GY + G S+ L+ KE+ RG++PD T AC+ + +G
Sbjct: 179 PQPDVVKWDVLMNGYVRCGLGSEGLEVFKEMLVRGIEPDEFSVTTALTACAQVGALAQGK 238

Query: 187 FQHFENMINHGIVPTVEHVNCLSELLSRSGCLKEAEKILQSMPASGDVAGWVSLLTACKA 8
+ H I V L ++ ++ GC++ A ++ + + +V W +L+ A
Sbjct: 239 WIHEFVKKKRWIESDVFVGTALVDMYAKCGCIETAVEVFEKL-TRRNVFSWAALIGGYAA 297

Query: 7 YG 2
YG
Sbjct: 298 YG 299


>sp|Q9LJJ1|PP259_ARATH Putative pentatricopeptide repeat-containing
protein At3g28640 OS=Arabidopsis thaliana GN=PCMP-E79
PE=3 SV=1
Length = 504

Score = 143 bits (361), Expect = 6e-34
Identities = 73/200 (36%), Positives = 118/200 (59%), Gaps = 3/200 (1%)
Frame = -2

Query: 595 LEILELMQSRGMKADKVTLLSCAMACGSMGAFEQGKLIHELIVRDAF-ESDILVGTTLVD 419
LE+ M +G++ D+ ++ + AC +GA QGK IHE + + ++ ESD+ VGT LVD
Sbjct: 203 LEVFREMLVKGLEPDEFSVTTALTACAQVGALAQGKWIHEFVKKKSWIESDVFVGTALVD 262

Query: 418 MYSKFGSLDEASNVFNRLANPHVVSWTALIVGYAQQGKISDALKCMKELEKR-GLQPDGK 242
MY+K G ++ A VF +L +V SW ALI GYA G A+ C++ LE+ G++PD
Sbjct: 263 MYAKCGCIETAVEVFKKLTRRNVFSWAALIGGYAAYGYAKKAMTCLERLEREDGIKPDSV 322

Query: 241 IYVTLFMACSHACHVDEGFQHFENM-INHGIVPTVEHVNCLSELLSRSGCLKEAEKILQS 65
+ + + AC+H ++EG ENM + I P EH +C+ +L+ R+G L +A +++
Sbjct: 323 VLLGVLAACAHGGFLEEGRSMLENMEARYEITPKHEHYSCIVDLMCRAGRLDDALNLIEK 382

Query: 64 MPASGDVAGWVSLLTACKAY 5
MP + W +LL C+ +
Sbjct: 383 MPMKPLASVWGALLNGCRTH 402



Score = 70.1 bits (170), Expect = 9e-12
Identities = 50/182 (27%), Positives = 90/182 (49%), Gaps = 2/182 (1%)
Frame = -2

Query: 541 LLSCAMACGSMGAFEQGKLIHELIVRDA-FESDILVGTTLVDMYSKFGSLDEASNVFNRL 365
+++C AC F GK IH +V++ F SD V T ++ +Y + L +A VF+ +
Sbjct: 123 IVACLKAC----FFSVGKQIHCWVVKNGVFLSDSHVQTGVLRIYVEDKLLLDARKVFDEI 178

Query: 364 ANPHVVSWTALIVGYAQQGKISDALKCMKELEKRGLQPDGKIYVTLFMACSHACHVDEGF 185
P VV W L+ GY + G S+ L+ +E+ +GL+PD T AC+ + +G
Sbjct: 179 PQPDVVKWDVLMNGYVRCGLGSEGLEVFREMLVKGLEPDEFSVTTALTACAQVGALAQGK 238

Query: 184 QHFENMINHGIVPTVEHV-NCLSELLSRSGCLKEAEKILQSMPASGDVAGWVSLLTACKA 8
E + + + V L ++ ++ GC++ A ++ + + +V W +L+ A
Sbjct: 239 WIHEFVKKKSWIESDVFVGTALVDMYAKCGCIETAVEVFKKL-TRRNVFSWAALIGGYAA 297

Query: 7 YG 2
YG
Sbjct: 298 YG 299


>sp|O04659|PP398_ARATH Pentatricopeptide repeat-containing protein
At5g27110 OS=Arabidopsis thaliana GN=PCMP-E14 PE=2 SV=2
Length = 691

Score = 143 bits (360), Expect = 8e-34
Identities = 79/196 (40%), Positives = 114/196 (58%), Gaps = 2/196 (1%)
Frame = -2

Query: 595 LEILELMQSRGMKADKVTLLSCAMACGSMGAFEQGKLIHELIVRDAFESDILVGTTLVDM 416
+E+ + M S G+K D VT S AC + A E+GK IH I E+D L+ + L+DM
Sbjct: 395 VEVYDQMVSVGVKPDVVTFTSVLPACSQLAALEKGKQIHLSISESRLETDELLLSALLDM 454

Query: 415 YSKFGSLDEASNVFNRLANPHVVSWTALIVGYAQQGKISDALKCMKELEKRGLQPDGKIY 236
YSK G+ EA +FN + VVSWT +I Y G+ +AL E++K GL+PDG
Sbjct: 455 YSKCGNEKEAFRIFNSIPKKDVVSWTVMISAYGSHGQPREALYQFDEMQKFGLKPDGVTL 514

Query: 235 VTLFMACSHACHVDEGFQHFENM-INHGIVPTVEHVNCLSELLSRSGCLKEAEKILQSMP 59
+ + AC HA +DEG + F M +GI P +EH +C+ ++L R+G L EA +I+Q P
Sbjct: 515 LAVLSACGHAGLIDEGLKFFSQMRSKYGIEPIIEHYSCMIDILGRAGRLLEAYEIIQQTP 574

Query: 58 ASGDVAGWVS-LLTAC 14
+ D A +S L +AC
Sbjct: 575 ETSDNAELLSTLFSAC 590



Score = 92.0 bits (227), Expect = 2e-18
Identities = 55/198 (27%), Positives = 95/198 (47%)
Frame = -2

Query: 595 LEILELMQSRGMKADKVTLLSCAMACGSMGAFEQGKLIHELIVRDAFESDILVGTTLVDM 416
+EIL M G + + TL S MAC GK IH ++R +DI V +L+D+
Sbjct: 294 VEILNRMIIEGTRPSQTTLTSILMACSRSRNLLHGKFIHGYVIRSVVNADIYVNCSLIDL 353

Query: 415 YSKFGSLDEASNVFNRLANPHVVSWTALIVGYAQQGKISDALKCMKELEKRGLQPDGKIY 236
Y K G + A VF++ SW +I Y G A++ ++ G++PD +
Sbjct: 354 YFKCGEANLAETVFSKTQKDVAESWNVMISSYISVGNWFKAVEVYDQMVSVGVKPDVVTF 413

Query: 235 VTLFMACSHACHVDEGFQHFENMINHGIVPTVEHVNCLSELLSRSGCLKEAEKILQSMPA 56
++ ACS +++G Q ++ + ++ L ++ S+ G KEA +I S+P
Sbjct: 414 TSVLPACSQLAALEKGKQIHLSISESRLETDELLLSALLDMYSKCGNEKEAFRIFNSIPK 473

Query: 55 SGDVAGWVSLLTACKAYG 2
DV W +++A ++G
Sbjct: 474 K-DVVSWTVMISAYGSHG 490



Score = 91.3 bits (225), Expect = 4e-18
Identities = 57/202 (28%), Positives = 97/202 (48%), Gaps = 2/202 (0%)
Frame = -2

Query: 601 DTLEILE-LMQSRGMKADKVTLLSCAMACGSMGAFEQGKLIHELIVRDAFESDILVGTTL 425
DTLE+ + L+ D T + A G++G G++IH L+V+ + D++V ++L
Sbjct: 89 DTLEVFKRLLNCSICVPDSFTFPNVIKAYGALGREFLGRMIHTLVVKSGYVCDVVVASSL 148

Query: 424 VDMYSKFGSLDEASNVFNRLANPHVVSWTALIVGYAQQGKISDALKCMKELEKRGLQPDG 245
V MY+KF + + VF+ + V SW +I + Q G+ AL+ +E G +P+
Sbjct: 149 VGMYAKFNLFENSLQVFDEMPERDVASWNTVISCFYQSGEAEKALELFGRMESSGFEPNS 208

Query: 244 KIYVTLFMACSHACHVDEGFQHFENMINHGIVPTVEHVN-CLSELLSRSGCLKEAEKILQ 68
ACS ++ G + + G E+VN L ++ + CL+ A ++ Q
Sbjct: 209 VSLTVAISACSRLLWLERGKEIHRKCVKKGF-ELDEYVNSALVDMYGKCDCLEVAREVFQ 267

Query: 67 SMPASGDVAGWVSLLTACKAYG 2
MP VA W S++ A G
Sbjct: 268 KMPRKSLVA-WNSMIKGYVAKG 288



Score = 84.0 bits (206), Expect = 6e-16
Identities = 51/175 (29%), Positives = 85/175 (48%), Gaps = 1/175 (0%)
Frame = -2

Query: 595 LEILELMQSRGMKADKVTLLSCAMACGSMGAFEQGKLIHELIVRDAFESDILVGTTLVDM 416
LE+ M+S G + + V+L AC + E+GK IH V+ FE D V + LVDM
Sbjct: 193 LELFGRMESSGFEPNSVSLTVAISACSRLLWLERGKEIHRKCVKKGFELDEYVNSALVDM 252

Query: 415 YSKFGSLDEASNVFNRLANPHVVSWTALIVGYAQQGKISDALKCMKELEKRGLQPDGKIY 236
Y K L+ A VF ++ +V+W ++I GY +G ++ + + G +P
Sbjct: 253 YGKCDCLEVAREVFQKMPRKSLVAWNSMIKGYVAKGDSKSCVEILNRMIIEGTRPSQTTL 312

Query: 235 VTLFMACSHACHVDEGFQHFENMINHGIVPTVEHVNC-LSELLSRSGCLKEAEKI 74
++ MACS + ++ G + + +V +VNC L +L + G AE +
Sbjct: 313 TSILMACSRSRNLLHG-KFIHGYVIRSVVNADIYVNCSLIDLYFKCGEANLAETV 366


>sp|Q9SZT8|PP354_ARATH Pentatricopeptide repeat-containing protein
At4g37380, chloroplastic OS=Arabidopsis thaliana
GN=PCMP-H48 PE=2 SV=1
Length = 632

Score = 142 bits (359), Expect = 1e-33
Identities = 78/203 (38%), Positives = 116/203 (57%), Gaps = 3/203 (1%)
Frame = -2

Query: 601 DTLEILELMQSRGM-KADKVTLLSCAMACGSMGAFEQGKLIHELIVRDAFESDILVGTTL 425
D L + + + + G K D++T+++ AC +GA E G+ IH + ++ V T L
Sbjct: 241 DALMLFQKLLAEGKPKPDEITVVAALSACSQIGALETGRWIHVFVKSSRIRLNVKVCTGL 300

Query: 424 VDMYSKFGSLDEASNVFNRLANPHVVSWTALIVGYAQQGKISDALKCMKELEK-RGLQPD 248
+DMYSK GSL+EA VFN +V+W A+I GYA G DAL+ E++ GLQP
Sbjct: 301 IDMYSKCGSLEEAVLVFNDTPRKDIVAWNAMIAGYAMHGYSQDALRLFNEMQGITGLQPT 360

Query: 247 GKIYVTLFMACSHACHVDEGFQHFENM-INHGIVPTVEHVNCLSELLSRSGCLKEAEKIL 71
++ AC+HA V+EG + FE+M +GI P +EH CL LL R+G LK A + +
Sbjct: 361 DITFIGTLQACAHAGLVNEGIRIFESMGQEYGIKPKIEHYGCLVSLLGRAGQLKRAYETI 420

Query: 70 QSMPASGDVAGWVSLLTACKAYG 2
++M D W S+L +CK +G
Sbjct: 421 KNMNMDADSVLWSSVLGSCKLHG 443



Score = 61.2 bits (147), Expect = 4e-09
Identities = 55/222 (24%), Positives = 90/222 (40%), Gaps = 32/222 (14%)
Frame = -2

Query: 571 SRGMKADKVTLLSCAMACGSMGAFEQGKLIHELIVRDAFESDILVGTTLVDMYSKFGSLD 392
S + ++ T S +C + + GKLIH +++ D V T LVD+Y+K G +
Sbjct: 123 SSEINPNEFTFSSLLKSCST----KSGKLIHTHVLKFGLGIDPYVATGLVDVYAKGGDVV 178

Query: 391 EASNVFNRL-------------------------------ANPHVVSWTALIVGYAQQGK 305
A VF+R+ +VSW +I GYAQ G
Sbjct: 179 SAQKVFDRMPERSLVSSTAMITCYAKQGNVEAARALFDSMCERDIVSWNVMIDGYAQHGF 238

Query: 304 ISDALKCMKELEKRGL-QPDGKIYVTLFMACSHACHVDEGFQHFENMINHGIVPTVEHVN 128
+DAL ++L G +PD V ACS ++ G + + I V+
Sbjct: 239 PNDALMLFQKLLAEGKPKPDEITVVAALSACSQIGALETGRWIHVFVKSSRIRLNVKVCT 298

Query: 127 CLSELLSRSGCLKEAEKILQSMPASGDVAGWVSLLTACKAYG 2
L ++ S+ G L+EA + P D+ W +++ +G
Sbjct: 299 GLIDMYSKCGSLEEAVLVFNDTPRK-DIVAWNAMIAGYAMHG 339


>sp|Q9LTV8|PP224_ARATH Pentatricopeptide repeat-containing protein
At3g12770 OS=Arabidopsis thaliana GN=PCMP-H43 PE=2 SV=1
Length = 694

Score = 142 bits (357), Expect = 2e-33
Identities = 64/199 (32%), Positives = 120/199 (60%)
Frame = -2

Query: 601 DTLEILELMQSRGMKADKVTLLSCAMACGSMGAFEQGKLIHELIVRDAFESDILVGTTLV 422
+ +++ M ++ ++ D +++ S AC +G+ EQ + ++E + R + D+ + + L+
Sbjct: 306 EAIDMFHEMINKDVRPDTISITSAISACAQVGSLEQARSMYEYVGRSDYRDDVFISSALI 365

Query: 421 DMYSKFGSLDEASNVFNRLANPHVVSWTALIVGYAQQGKISDALKCMKELEKRGLQPDGK 242
DM++K GS++ A VF+R + VV W+A+IVGY G+ +A+ + +E+ G+ P+
Sbjct: 366 DMFAKCGSVEGARLVFDRTLDRDVVVWSAMIVGYGLHGRAREAISLYRAMERGGVHPNDV 425

Query: 241 IYVTLFMACSHACHVDEGFQHFENMINHGIVPTVEHVNCLSELLSRSGCLKEAEKILQSM 62
++ L MAC+H+ V EG+ F M +H I P +H C+ +LL R+G L +A ++++ M
Sbjct: 426 TFLGLLMACNHSGMVREGWWFFNRMADHKINPQQQHYACVIDLLGRAGHLDQAYEVIKCM 485

Query: 61 PASGDVAGWVSLLTACKAY 5
P V W +LL+ACK +
Sbjct: 486 PVQPGVTVWGALLSACKKH 504



Score = 75.5 bits (184), Expect = 2e-13
Identities = 49/196 (25%), Positives = 94/196 (47%), Gaps = 2/196 (1%)
Frame = -2

Query: 601 DTLEILELMQSRGMKADKVTLLSCAMACGSMGAFEQGKLIHELIVRDAFESDILVGTTLV 422
D L + MQ + D T AC + + G+ +H + R F++D+ V L+
Sbjct: 102 DALLMYSNMQLARVSPDSFTFPHLLKACSGLSHLQMGRFVHAQVFRLGFDADVFVQNGLI 161

Query: 421 DMYSKFGSLDEASNVFNRLANPH--VVSWTALIVGYAQQGKISDALKCMKELEKRGLQPD 248
+Y+K L A VF L P +VSWTA++ YAQ G+ +AL+ ++ K ++PD
Sbjct: 162 ALYAKCRRLGSARTVFEGLPLPERTIVSWTAIVSAYAQNGEPMEALEIFSQMRKMDVKPD 221

Query: 247 GKIYVTLFMACSHACHVDEGFQHFENMINHGIVPTVEHVNCLSELLSRSGCLKEAEKILQ 68
V++ A + + +G +++ G+ + + L+ + ++ G + A KIL
Sbjct: 222 WVALVSVLNAFTCLQDLKQGRSIHASVVKMGLEIEPDLLISLNTMYAKCGQVATA-KILF 280

Query: 67 SMPASGDVAGWVSLLT 20
S ++ W ++++
Sbjct: 281 DKMKSPNLILWNAMIS 296



Score = 74.7 bits (182), Expect = 4e-13
Identities = 46/201 (22%), Positives = 97/201 (48%)
Frame = -2

Query: 604 LDTLEILELMQSRGMKADKVTLLSCAMACGSMGAFEQGKLIHELIVRDAFESDILVGTTL 425
++ LEI M+ +K D V L+S A + +QG+ IH +V+ E + + +L
Sbjct: 204 MEALEIFSQMRKMDVKPDWVALVSVLNAFTCLQDLKQGRSIHASVVKMGLEIEPDLLISL 263

Query: 424 VDMYSKFGSLDEASNVFNRLANPHVVSWTALIVGYAQQGKISDALKCMKELEKRGLQPDG 245
MY+K G + A +F+++ +P+++ W A+I GYA+ G +A+ E+ + ++PD
Sbjct: 264 NTMYAKCGQVATAKILFDKMKSPNLILWNAMISGYAKNGYAREAIDMFHEMINKDVRPDT 323

Query: 244 KIYVTLFMACSHACHVDEGFQHFENMINHGIVPTVEHVNCLSELLSRSGCLKEAEKILQS 65
+ AC+ +++ +E + V + L ++ ++ G + E +++
Sbjct: 324 ISITSAISACAQVGSLEQARSMYEYVGRSDYRDDVFISSALIDMFAKCGSV-EGARLVFD 382

Query: 64 MPASGDVAGWVSLLTACKAYG 2
DV W +++ +G
Sbjct: 383 RTLDRDVVVWSAMIVGYGLHG 403



Score = 58.2 bits (139), Expect = 3e-08
Identities = 40/161 (24%), Positives = 67/161 (41%), Gaps = 1/161 (0%)
Frame = -2

Query: 496 QGKLIHELIVRDAFESDILVGTTLVDMYSKFGSLDEASNVFNRLANPHVVSWTALIVGYA 317
Q K IH ++ + + T L+ S FG + A VF+ L P + W A+I GY+
Sbjct: 36 QLKQIHARLLVLGLQFSGFLITKLIHASSSFGDITFARQVFDDLPRPQIFPWNAIIRGYS 95

Query: 316 QQGKISDALKCMKELEKRGLQPDGKIYVTLFMACSHACHVDEGFQHFENMINHGIVPTVE 137
+ DAL ++ + PD + L ACS H+ G + G V
Sbjct: 96 RNNHFQDALLMYSNMQLARVSPDSFTFPHLLKACSGLSHLQMGRFVHAQVFRLGFDADVF 155

Query: 136 HVNCLSELLSRSGCLKEAEKILQSMP-ASGDVAGWVSLLTA 17
N L L ++ L A + + +P + W ++++A
Sbjct: 156 VQNGLIALYAKCRRLGSARTVFEGLPLPERTIVSWTAIVSA 196


>sp|O23266|PP308_ARATH Pentatricopeptide repeat-containing protein
At4g14050, mitochondrial OS=Arabidopsis thaliana
GN=PCMP-H13 PE=2 SV=3
Length = 612

Score = 141 bits (356), Expect = 2e-33
Identities = 72/195 (36%), Positives = 116/195 (59%), Gaps = 1/195 (0%)
Frame = -2

Query: 583 ELMQSRGMKADKVTLLSCAMACGSMGAFEQGKLIHELIVRDAFESDILVGTTLVDMYSKF 404
E+ + R D + L S AC ++ A G+ +H L++ F+S + + L+DMY+K
Sbjct: 227 EMRRERVDILDPLVLSSIVGACANLAASIAGRQVHGLVIALGFDSCVFISNALIDMYAKC 286

Query: 403 GSLDEASNVFNRLANPHVVSWTALIVGYAQQGKISDALKCMKELEKRGLQPDGKIYVTLF 224
+ A ++F+R+ + VVSWT+LIVG AQ G+ AL ++ G++P+ +V L
Sbjct: 287 SDVIAAKDIFSRMRHRDVVSWTSLIVGMAQHGQAEKALALYDDMVSHGVKPNEVTFVGLI 346

Query: 223 MACSHACHVDEGFQHFENMI-NHGIVPTVEHVNCLSELLSRSGCLKEAEKILQSMPASGD 47
ACSH V++G + F++M ++GI P+++H CL +LL RSG L EAE ++ +MP D
Sbjct: 347 YACSHVGFVEKGRELFQSMTKDYGIRPSLQHYTCLLDLLGRSGLLDEAENLIHTMPFPPD 406

Query: 46 VAGWVSLLTACKAYG 2
W +LL+ACK G
Sbjct: 407 EPTWAALLSACKRQG 421



Score = 72.4 bits (176), Expect = 2e-12
Identities = 33/105 (31%), Positives = 62/105 (59%)
Frame = -2

Query: 571 SRGMKADKVTLLSCAMACGSMGAFEQGKLIHELIVRDAFESDILVGTTLVDMYSKFGSLD 392
S G++ D + AC ++G+ + G+ +H + + +D +V ++LVDMY+K G L+
Sbjct: 98 SSGLRPDDFVFSALVKACANLGSIDHGRQVHCHFIVSEYANDEVVKSSLVDMYAKCGLLN 157

Query: 391 EASNVFNRLANPHVVSWTALIVGYAQQGKISDALKCMKELEKRGL 257
A VF+ + + +SWTA++ GYA+ G+ +AL+ + L + L
Sbjct: 158 SAKAVFDSIRVKNTISWTAMVSGYAKSGRKEEALELFRILPVKNL 202



Score = 50.8 bits (120), Expect = 6e-06
Identities = 34/168 (20%), Positives = 70/168 (41%), Gaps = 1/168 (0%)
Frame = -2

Query: 520 CGSMGAFEQGKLIHELIVRDAFESDILVGTTLVDMYSKFGSLDEASNVFNRLANPHVVSW 341
C K +H IV+ + TLV++Y K G+ A VF+ + + ++W
Sbjct: 13 CARNRTLTTAKALHAHIVKLGIVQCCPLANTLVNVYGKCGAASHALQVFDEMPHRDHIAW 72

Query: 340 TALIVGYAQQGKISDALKCMKEL-EKRGLQPDGKIYVTLFMACSHACHVDEGFQHFENMI 164
+++ Q L + GL+PD ++ L AC++ +D G Q + I
Sbjct: 73 ASVLTALNQANLSGKTLSVFSSVGSSSGLRPDDFVFSALVKACANLGSIDHGRQVHCHFI 132

Query: 163 NHGIVPTVEHVNCLSELLSRSGCLKEAEKILQSMPASGDVAGWVSLLT 20
+ L ++ ++ G L A+ + S+ ++ W ++++
Sbjct: 133 VSEYANDEVVKSSLVDMYAKCGLLNSAKAVFDSIRVKNTIS-WTAMVS 179



Score = 49.3 bits (116), Expect = 2e-05
Identities = 32/125 (25%), Positives = 59/125 (47%), Gaps = 2/125 (1%)
Frame = -2

Query: 595 LEILELMQSRGMKADKVTLLSCAMACGSMGAFEQGKLIHELIVRD-AFESDILVGTTLVD 419
L + + M S G+K ++VT + AC +G E+G+ + + + +D + T L+D
Sbjct: 324 LALYDDMVSHGVKPNEVTFVGLIYACSHVGFVEKGRELFQSMTKDYGIRPSLQHYTCLLD 383

Query: 418 MYSKFGSLDEASNVFNRLA-NPHVVSWTALIVGYAQQGKISDALKCMKELEKRGLQPDGK 242
+ + G LDEA N+ + + P +W AL+ +QG+ ++ L D
Sbjct: 384 LLGRSGLLDEAENLIHTMPFPPDEPTWAALLSACKRQGRGQMGIRIADHLVSSFKLKDPS 443

Query: 241 IYVTL 227
Y+ L
Sbjct: 444 TYILL 448


tr_hit_id A7PEX5
Definition tr|A7PEX5|A7PEX5_VITVI Chromosome chr11 scaffold_13, whole genome shotgun sequence OS=Vitis vinifera
Align length 201
Score (bit) 164.0
E-value 5.0e-39
Report
BLASTX 2.2.19 [Nov-02-2008]


Reference: Altschul, Stephen F., Thomas L. Madden, Alejandro A. Schaffer,
Jinghui Zhang, Zheng Zhang, Webb Miller, and David J. Lipman (1997),
"Gapped BLAST and PSI-BLAST: a new generation of protein database search
programs", Nucleic Acids Res. 25:3389-3402.

Query= BP918438|Adiantum capillus-veneris mRNA, clone:
YMU001_000113_E05.
(620 letters)

Database: uniprot_trembl.fasta
7,341,751 sequences; 2,391,615,440 total letters

Searching..................................................done



Score E
Sequences producing significant alignments: (bits) Value

tr|A7PEX5|A7PEX5_VITVI Chromosome chr11 scaffold_13, whole genom... 164 5e-39
tr|Q5W964|Q5W964_PHYPA PPR986-12 OS=Physcomitrella patens PE=2 SV=1 160 4e-38
tr|A9TNX6|A9TNX6_PHYPA Predicted protein OS=Physcomitrella paten... 160 4e-38
tr|A9RJW2|A9RJW2_PHYPA Predicted protein OS=Physcomitrella paten... 160 7e-38
tr|Q7XUF2|Q7XUF2_ORYSJ Os04g0488200 protein OS=Oryza sativa subs... 159 1e-37
tr|A5CBT0|A5CBT0_VITVI Putative uncharacterized protein OS=Vitis... 159 1e-37
tr|A2XUW3|A2XUW3_ORYSI Putative uncharacterized protein OS=Oryza... 159 1e-37
tr|A7PRP0|A7PRP0_VITVI Chromosome chr14 scaffold_27, whole genom... 159 2e-37
tr|A7PNH6|A7PNH6_VITVI Chromosome chr1 scaffold_22, whole genome... 158 2e-37
tr|A9T8E9|A9T8E9_PHYPA Predicted protein OS=Physcomitrella paten... 157 4e-37
tr|A7Q1A2|A7Q1A2_VITVI Chromosome chr10 scaffold_43, whole genom... 155 1e-36
tr|Q5W963|Q5W963_PHYPA PPR1106-17 OS=Physcomitrella patens PE=2 ... 155 2e-36
tr|B8LLJ0|B8LLJ0_PICSI Putative uncharacterized protein OS=Picea... 155 2e-36
tr|A7R380|A7R380_VITVI Chromosome undetermined scaffold_490, who... 154 3e-36
tr|A9TDA2|A9TDA2_PHYPA Predicted protein OS=Physcomitrella paten... 154 4e-36
tr|A7R1T0|A7R1T0_VITVI Chromosome undetermined scaffold_376, who... 154 5e-36
tr|Q6F382|Q6F382_ORYSJ Os03g0795200 protein OS=Oryza sativa subs... 153 7e-36
tr|A7NWP9|A7NWP9_VITVI Chromosome chr5 scaffold_2, whole genome ... 153 7e-36
tr|A3ANL0|A3ANL0_ORYSJ Putative uncharacterized protein OS=Oryza... 153 7e-36
tr|A2XMV7|A2XMV7_ORYSI Putative uncharacterized protein OS=Oryza... 153 7e-36
tr|A7PZB8|A7PZB8_VITVI Chromosome chr15 scaffold_40, whole genom... 152 2e-35
tr|Q7EXY6|Q7EXY6_ORYSJ Os08g0511000 protein OS=Oryza sativa subs... 151 3e-35
tr|B8BCB9|B8BCB9_ORYSI Putative uncharacterized protein OS=Oryza... 151 3e-35
tr|A7PEI5|A7PEI5_VITVI Chromosome chr11 scaffold_13, whole genom... 151 3e-35
tr|A7PDX6|A7PDX6_VITVI Chromosome chr11 scaffold_13, whole genom... 151 3e-35
tr|A3BUR2|A3BUR2_ORYSJ Putative uncharacterized protein OS=Oryza... 151 3e-35
tr|A7Q9C2|A7Q9C2_VITVI Chromosome chr19 scaffold_66, whole genom... 150 4e-35
tr|A5C6H0|A5C6H0_VITVI Putative uncharacterized protein OS=Vitis... 150 4e-35
tr|A5APN9|A5APN9_VITVI Putative uncharacterized protein OS=Vitis... 150 4e-35
tr|B4F908|B4F908_MAIZE Putative uncharacterized protein OS=Zea m... 150 6e-35

>tr|A7PEX5|A7PEX5_VITVI Chromosome chr11 scaffold_13, whole genome
shotgun sequence OS=Vitis vinifera GN=GSVIVT00016825001
PE=4 SV=1
Length = 711

Score = 164 bits (414), Expect = 5e-39
Identities = 83/201 (41%), Positives = 126/201 (62%), Gaps = 1/201 (0%)
Frame = -2

Query: 601 DTLEILELMQSRGMKADKVTLLSCAMACGSMGAFEQGKLIHELIVRDAFESDILVGTTLV 422
+ L + MQ G+K DKVT+ S +AC +GA E GK +H I ++ E D+ +GT LV
Sbjct: 322 EALSLFNEMQLSGVKGDKVTMASLLIACTHLGALELGKWLHVYIEKEKIEVDVALGTALV 381

Query: 421 DMYSKFGSLDEASNVFNRLANPHVVSWTALIVGYAQQGKISDALKCMKELEKRGLQPDGK 242
DMY+K GS++ A VF + V++WTALIVG A G+ AL+ E++ ++PD
Sbjct: 382 DMYAKCGSIESAMRVFQEMPEKDVMTWTALIVGLAMCGQGLKALELFHEMQMSEVKPDAI 441

Query: 241 IYVTLFMACSHACHVDEGFQHFENMIN-HGIVPTVEHVNCLSELLSRSGCLKEAEKILQS 65
+V + ACSHA V+EG +F +M N +GI P++EH C+ ++L R+G + EAE ++Q+
Sbjct: 442 TFVGVLAACSHAGLVNEGIAYFNSMPNKYGIQPSIEHYGCMVDMLGRAGRIAEAEDLIQN 501

Query: 64 MPASGDVAGWVSLLTACKAYG 2
MP + D V LL+AC+ +G
Sbjct: 502 MPMAPDYFVLVGLLSACRIHG 522



Score = 79.0 bits (193), Expect = 2e-13
Identities = 49/175 (28%), Positives = 84/175 (48%)
Frame = -2

Query: 583 ELMQSRGMKADKVTLLSCAMACGSMGAFEQGKLIHELIVRDAFESDILVGTTLVDMYSKF 404
+LM +G+ D+ T S +CG + +GK +H + F SD + TL++MYS
Sbjct: 129 QLMMLQGLDPDRFTFPSLFKSCGVLC---EGKQLHCHSTKLGFASDAYIQNTLMNMYSNC 185

Query: 403 GSLDEASNVFNRLANPHVVSWTALIVGYAQQGKISDALKCMKELEKRGLQPDGKIYVTLF 224
G L A VF+++ N VVSW +I YAQ +A+K + +E ++P+ V +
Sbjct: 186 GCLVSARKVFDKMVNKSVVSWATMIGAYAQWDLPHEAIKLFRRMEIASVKPNEITLVNVL 245

Query: 223 MACSHACHVDEGFQHFENMINHGIVPTVEHVNCLSELLSRSGCLKEAEKILQSMP 59
AC+ + ++ Q + + GI + L ++ + GC A + MP
Sbjct: 246 TACARSRDLETAKQVHKYIDETGIGFHTVLTSALMDVYCKCGCYPLARDLFNKMP 300



Score = 77.0 bits (188), Expect = 8e-13
Identities = 44/200 (22%), Positives = 92/200 (46%)
Frame = -2

Query: 601 DTLEILELMQSRGMKADKVTLLSCAMACGSMGAFEQGKLIHELIVRDAFESDILVGTTLV 422
+ +++ M+ +K +++TL++ AC E K +H+ I ++ + L+
Sbjct: 221 EAIKLFRRMEIASVKPNEITLVNVLTACARSRDLETAKQVHKYIDETGIGFHTVLTSALM 280

Query: 421 DMYSKFGSLDEASNVFNRLANPHVVSWTALIVGYAQQGKISDALKCMKELEKRGLQPDGK 242
D+Y K G A ++FN++ ++ W +I G+ + +AL E++ G++ D
Sbjct: 281 DVYCKCGCYPLARDLFNKMPEKNLFCWNIMINGHVEDSDYEEALSLFNEMQLSGVKGDKV 340

Query: 241 IYVTLFMACSHACHVDEGFQHFENMINHGIVPTVEHVNCLSELLSRSGCLKEAEKILQSM 62
+L +AC+H ++ G + I V L ++ ++ G ++ A ++ Q M
Sbjct: 341 TMASLLIACTHLGALELGKWLHVYIEKEKIEVDVALGTALVDMYAKCGSIESAMRVFQEM 400

Query: 61 PASGDVAGWVSLLTACKAYG 2
P DV W +L+ G
Sbjct: 401 PEK-DVMTWTALIVGLAMCG 419



Score = 58.5 bits (140), Expect = 3e-07
Identities = 46/180 (25%), Positives = 75/180 (41%), Gaps = 2/180 (1%)
Frame = -2

Query: 550 KVTLLSCAMACGSMGAFEQGKLIHELIVRDAFESDILVGTTLVDMYSKF--GSLDEASNV 377
++ L C ++ Q K IH ++R D + +V + GSL A V
Sbjct: 37 QIQLHPCLLSLEKCTTMSQLKQIHAQMLRTCLFVDPFSASKIVAFCALHDSGSLPYARLV 96

Query: 376 FNRLANPHVVSWTALIVGYAQQGKISDALKCMKELEKRGLQPDGKIYVTLFMACSHACHV 197
FN++ NP + ++I GY + A+ + + +GL PD + +LF +C C
Sbjct: 97 FNQIPNPTTFTCNSIIRGYTNKNLPRQAILFYQLMMLQGLDPDRFTFPSLFKSCGVLC-- 154

Query: 196 DEGFQHFENMINHGIVPTVEHVNCLSELLSRSGCLKEAEKILQSMPASGDVAGWVSLLTA 17
EG Q + G N L + S GCL A K+ M + V W +++ A
Sbjct: 155 -EGKQLHCHSTKLGFASDAYIQNTLMNMYSNCGCLVSARKVFDKM-VNKSVVSWATMIGA 212


>tr|Q5W964|Q5W964_PHYPA PPR986-12 OS=Physcomitrella patens PE=2 SV=1
Length = 986

Score = 160 bits (406), Expect = 4e-38
Identities = 75/196 (38%), Positives = 119/196 (60%)
Frame = -2

Query: 592 EILELMQSRGMKADKVTLLSCAMACGSMGAFEQGKLIHELIVRDAFESDILVGTTLVDMY 413
+ ++MQ G+K DK+T AC S A +G+ +H LI AF+ D+LVGT L+ MY
Sbjct: 601 DYFKMMQESGIKPDKITFTGLLNACASPEALTEGRRLHALITEAAFDCDVLVGTGLISMY 660

Query: 412 SKFGSLDEASNVFNRLANPHVVSWTALIVGYAQQGKISDALKCMKELEKRGLQPDGKIYV 233
+K GS+++A VF++L +V SWT++I GYAQ G+ +AL+ ++++ G++PD +V
Sbjct: 661 TKCGSIEDAHQVFHKLPKKNVYSWTSMIAGYAQHGRGKEALELFYQMQQEGVKPDWITFV 720

Query: 232 TLFMACSHACHVDEGFQHFENMINHGIVPTVEHVNCLSELLSRSGCLKEAEKILQSMPAS 53
AC+HA ++EG HF++M I P +EH C+ +L R+G L EA + + M
Sbjct: 721 GALSACAHAGLIEEGLHHFQSMKEFNIEPRMEHYGCMVDLFGRAGLLNEAVEFIIKMQVE 780

Query: 52 GDVAGWVSLLTACKAY 5
D W +LL AC+ +
Sbjct: 781 PDSRVWGALLGACQVH 796



Score = 113 bits (282), Expect = 1e-23
Identities = 57/191 (29%), Positives = 109/191 (57%)
Frame = -2

Query: 589 ILELMQSRGMKADKVTLLSCAMACGSMGAFEQGKLIHELIVRDAFESDILVGTTLVDMYS 410
+ + M+ G++ DKV +S AC A EQGK +H + ++++I VGT ++ MY+
Sbjct: 299 LFQRMEEEGVQPDKVAFVSLLRACNHPEALEQGKKVHARMKEVGWDTEIYVGTAILSMYT 358

Query: 409 KFGSLDEASNVFNRLANPHVVSWTALIVGYAQQGKISDALKCMKELEKRGLQPDGKIYVT 230
K GS+++A VF+ + +VVSWTA+I G+AQ G+I +A ++ + G++P+ +++
Sbjct: 359 KCGSMEDALEVFDLVKGRNVVSWTAMIAGFAQHGRIDEAFLFFNKMIESGIEPNRVTFMS 418

Query: 229 LFMACSHACHVDEGFQHFENMINHGIVPTVEHVNCLSELLSRSGCLKEAEKILQSMPASG 50
+ ACS + G Q +++I G L + ++ G LK+A ++ + + +
Sbjct: 419 ILGACSSPSALKRGQQIQDHIIEAGYGSDDRVRTALLSMYAKCGSLKDAHRVFEKI-SKQ 477

Query: 49 DVAGWVSLLTA 17
+V W +++TA
Sbjct: 478 NVVAWNAMITA 488



Score = 100 bits (249), Expect = 7e-20
Identities = 50/200 (25%), Positives = 106/200 (53%)
Frame = -2

Query: 601 DTLEILELMQSRGMKADKVTLLSCAMACGSMGAFEQGKLIHELIVRDAFESDILVGTTLV 422
+ ++ E M +K DK T +S AC ++G+ ++ LI++ +++D+ VGT L+
Sbjct: 194 EAFKLHEQMVQDSVKPDKRTFVSMLNACADARNVDKGRELYNLILKAGWDTDLFVGTALI 253

Query: 421 DMYSKFGSLDEASNVFNRLANPHVVSWTALIVGYAQQGKISDALKCMKELEKRGLQPDGK 242
+M+ K G + +A+ VF+ L +V+WT++I G A+ G+ A + +E+ G+QPD
Sbjct: 254 NMHIKCGDIGDATKVFDNLPTRDLVTWTSMITGLARHGRFKQACNLFQRMEEEGVQPDKV 313

Query: 241 IYVTLFMACSHACHVDEGFQHFENMINHGIVPTVEHVNCLSELLSRSGCLKEAEKILQSM 62
+V+L AC+H +++G + M G + + + ++ G +++A ++ +
Sbjct: 314 AFVSLLRACNHPEALEQGKKVHARMKEVGWDTEIYVGTAILSMYTKCGSMEDALEVF-DL 372

Query: 61 PASGDVAGWVSLLTACKAYG 2
+V W +++ +G
Sbjct: 373 VKGRNVVSWTAMIAGFAQHG 392



Score = 94.4 bits (233), Expect = 5e-18
Identities = 54/193 (27%), Positives = 99/193 (51%), Gaps = 1/193 (0%)
Frame = -2

Query: 577 MQSRGMKADKVTLLSCAMACGSMGAFEQGKLIHELIVRDAFESDILVGTTLVDMYSKFGS 398
M G++ ++VT +S AC S A ++G+ I + I+ + SD V T L+ MY+K GS
Sbjct: 404 MIESGIEPNRVTFMSILGACSSPSALKRGQQIQDHIIEAGYGSDDRVRTALLSMYAKCGS 463

Query: 397 LDEASNVFNRLANPHVVSWTALIVGYAQQGKISDALKCMKELEKRGLQPDGKIYVTLFMA 218
L +A VF +++ +VV+W A+I Y Q + +AL + L K G++P+ + ++
Sbjct: 464 LKDAHRVFEKISKQNVVAWNAMITAYVQHEQYDNALATFQALLKEGIKPNSSTFTSILNV 523

Query: 217 CSHACHVDEG-FQHFENMINHGIVPTVEHVNCLSELLSRSGCLKEAEKILQSMPASGDVA 41
C + ++ G + HF ++ G+ + N L + G L A+ + MP D+
Sbjct: 524 CKSSDSLELGKWVHF-LIMKAGLESDLHVSNALVSMFVNCGDLMSAKNLFNDMP-KRDLV 581

Query: 40 GWVSLLTACKAYG 2
W +++ +G
Sbjct: 582 SWNTIIAGFVQHG 594



Score = 89.4 bits (220), Expect = 2e-16
Identities = 53/200 (26%), Positives = 92/200 (46%)
Frame = -2

Query: 601 DTLEILELMQSRGMKADKVTLLSCAMACGSMGAFEQGKLIHELIVRDAFESDILVGTTLV 422
+ L + + G+K + T S C S + E GK +H LI++ ESD+ V LV
Sbjct: 497 NALATFQALLKEGIKPNSSTFTSILNVCKSSDSLELGKWVHFLIMKAGLESDLHVSNALV 556

Query: 421 DMYSKFGSLDEASNVFNRLANPHVVSWTALIVGYAQQGKISDALKCMKELEKRGLQPDGK 242
M+ G L A N+FN + +VSW +I G+ Q GK A K +++ G++PD
Sbjct: 557 SMFVNCGDLMSAKNLFNDMPKRDLVSWNTIIAGFVQHGKNQVAFDYFKMMQESGIKPDKI 616

Query: 241 IYVTLFMACSHACHVDEGFQHFENMINHGIVPTVEHVNCLSELLSRSGCLKEAEKILQSM 62
+ L AC+ + EG + + V L + ++ G +++A ++ +
Sbjct: 617 TFTGLLNACASPEALTEGRRLHALITEAAFDCDVLVGTGLISMYTKCGSIEDAHQVFHKL 676

Query: 61 PASGDVAGWVSLLTACKAYG 2
P +V W S++ +G
Sbjct: 677 PKK-NVYSWTSMIAGYAQHG 695



Score = 88.6 bits (218), Expect = 3e-16
Identities = 48/200 (24%), Positives = 101/200 (50%)
Frame = -2

Query: 601 DTLEILELMQSRGMKADKVTLLSCAMACGSMGAFEQGKLIHELIVRDAFESDILVGTTLV 422
+ +++LE + S ++ + T + C G+ I+ I + + DI + TL+
Sbjct: 93 EAMQVLERVDSSHIQIYRQTYSALLQLCIKFKNLGDGERIYNHIKKSGVQPDIFMRNTLI 152

Query: 421 DMYSKFGSLDEASNVFNRLANPHVVSWTALIVGYAQQGKISDALKCMKELEKRGLQPDGK 242
+MY+K G+ A +F+ + V SW L+ GY Q G +A K +++ + ++PD +
Sbjct: 153 NMYAKCGNTISAKQIFDDMREKDVYSWNLLLGGYVQHGLYEEAFKLHEQMVQDSVKPDKR 212

Query: 241 IYVTLFMACSHACHVDEGFQHFENMINHGIVPTVEHVNCLSELLSRSGCLKEAEKILQSM 62
+V++ AC+ A +VD+G + + ++ G + L + + G + +A K+ ++
Sbjct: 213 TFVSMLNACADARNVDKGRELYNLILKAGWDTDLFVGTALINMHIKCGDIGDATKVFDNL 272

Query: 61 PASGDVAGWVSLLTACKAYG 2
P + D+ W S++T +G
Sbjct: 273 P-TRDLVTWTSMITGLARHG 291



Score = 37.0 bits (84), Expect = 0.94
Identities = 24/92 (26%), Positives = 40/92 (43%), Gaps = 1/92 (1%)
Frame = -2

Query: 601 DTLEILELMQSRGMKADKVTLLSCAMACGSMGAFEQGKLIHELIVRDAFESDILVGTTLV 422
+ LE+ MQ G+K D +T + AC G E+G + + E + +V
Sbjct: 699 EALELFYQMQQEGVKPDWITFVGALSACAHAGLIEEGLHHFQSMKEFNIEPRMEHYGCMV 758

Query: 421 DMYSKFGSLDEASN-VFNRLANPHVVSWTALI 329
D++ + G L+EA + P W AL+
Sbjct: 759 DLFGRAGLLNEAVEFIIKMQVEPDSRVWGALL 790


>tr|A9TNX6|A9TNX6_PHYPA Predicted protein OS=Physcomitrella patens
subsp. patens GN=PHYPADRAFT_224041 PE=4 SV=1
Length = 986

Score = 160 bits (406), Expect = 4e-38
Identities = 75/196 (38%), Positives = 119/196 (60%)
Frame = -2

Query: 592 EILELMQSRGMKADKVTLLSCAMACGSMGAFEQGKLIHELIVRDAFESDILVGTTLVDMY 413
+ ++MQ G+K DK+T AC S A +G+ +H LI AF+ D+LVGT L+ MY
Sbjct: 601 DYFKMMQESGIKPDKITFTGLLNACASPEALTEGRRLHALITEAAFDCDVLVGTGLISMY 660

Query: 412 SKFGSLDEASNVFNRLANPHVVSWTALIVGYAQQGKISDALKCMKELEKRGLQPDGKIYV 233
+K GS+++A VF++L +V SWT++I GYAQ G+ +AL+ ++++ G++PD +V
Sbjct: 661 TKCGSIEDAHQVFHKLPKKNVYSWTSMITGYAQHGRGKEALELFYQMQQEGVKPDWITFV 720

Query: 232 TLFMACSHACHVDEGFQHFENMINHGIVPTVEHVNCLSELLSRSGCLKEAEKILQSMPAS 53
AC+HA ++EG HF++M I P +EH C+ +L R+G L EA + + M
Sbjct: 721 GALSACAHAGLIEEGLHHFQSMKEFNIEPRMEHYGCMVDLFGRAGLLNEAVEFIIKMQVE 780

Query: 52 GDVAGWVSLLTACKAY 5
D W +LL AC+ +
Sbjct: 781 PDSRVWGALLGACQVH 796



Score = 113 bits (282), Expect = 1e-23
Identities = 57/191 (29%), Positives = 109/191 (57%)
Frame = -2

Query: 589 ILELMQSRGMKADKVTLLSCAMACGSMGAFEQGKLIHELIVRDAFESDILVGTTLVDMYS 410
+ + M+ G++ DKV +S AC A EQGK +H + ++++I VGT ++ MY+
Sbjct: 299 LFQRMEEEGVQPDKVAFVSLLRACNHPEALEQGKKVHARMKEVGWDTEIYVGTAILSMYT 358

Query: 409 KFGSLDEASNVFNRLANPHVVSWTALIVGYAQQGKISDALKCMKELEKRGLQPDGKIYVT 230
K GS+++A VF+ + +VVSWTA+I G+AQ G+I +A ++ + G++P+ +++
Sbjct: 359 KCGSMEDALEVFDLVKGRNVVSWTAMIAGFAQHGRIDEAFLFFNKMIESGIEPNRVTFMS 418

Query: 229 LFMACSHACHVDEGFQHFENMINHGIVPTVEHVNCLSELLSRSGCLKEAEKILQSMPASG 50
+ ACS + G Q +++I G L + ++ G LK+A ++ + + +
Sbjct: 419 ILGACSSPSALKRGQQIQDHIIEAGYGSDDRVRTALLSMYAKCGSLKDAHRVFEKI-SKQ 477

Query: 49 DVAGWVSLLTA 17
+V W +++TA
Sbjct: 478 NVVAWNAMITA 488



Score = 100 bits (249), Expect = 7e-20
Identities = 50/200 (25%), Positives = 106/200 (53%)
Frame = -2

Query: 601 DTLEILELMQSRGMKADKVTLLSCAMACGSMGAFEQGKLIHELIVRDAFESDILVGTTLV 422
+ ++ E M +K DK T +S AC ++G+ ++ LI++ +++D+ VGT L+
Sbjct: 194 EAFKLHEQMVQDSVKPDKRTFVSMLNACADARNVDKGRELYNLILKAGWDTDLFVGTALI 253

Query: 421 DMYSKFGSLDEASNVFNRLANPHVVSWTALIVGYAQQGKISDALKCMKELEKRGLQPDGK 242
+M+ K G + +A+ VF+ L +V+WT++I G A+ G+ A + +E+ G+QPD
Sbjct: 254 NMHIKCGDIGDATKVFDNLPTRDLVTWTSMITGLARHGRFKQACNLFQRMEEEGVQPDKV 313

Query: 241 IYVTLFMACSHACHVDEGFQHFENMINHGIVPTVEHVNCLSELLSRSGCLKEAEKILQSM 62
+V+L AC+H +++G + M G + + + ++ G +++A ++ +
Sbjct: 314 AFVSLLRACNHPEALEQGKKVHARMKEVGWDTEIYVGTAILSMYTKCGSMEDALEVF-DL 372

Query: 61 PASGDVAGWVSLLTACKAYG 2
+V W +++ +G
Sbjct: 373 VKGRNVVSWTAMIAGFAQHG 392



Score = 94.4 bits (233), Expect = 5e-18
Identities = 54/193 (27%), Positives = 99/193 (51%), Gaps = 1/193 (0%)
Frame = -2

Query: 577 MQSRGMKADKVTLLSCAMACGSMGAFEQGKLIHELIVRDAFESDILVGTTLVDMYSKFGS 398
M G++ ++VT +S AC S A ++G+ I + I+ + SD V T L+ MY+K GS
Sbjct: 404 MIESGIEPNRVTFMSILGACSSPSALKRGQQIQDHIIEAGYGSDDRVRTALLSMYAKCGS 463

Query: 397 LDEASNVFNRLANPHVVSWTALIVGYAQQGKISDALKCMKELEKRGLQPDGKIYVTLFMA 218
L +A VF +++ +VV+W A+I Y Q + +AL + L K G++P+ + ++
Sbjct: 464 LKDAHRVFEKISKQNVVAWNAMITAYVQHEQYDNALATFQALLKEGIKPNSSTFTSILNV 523

Query: 217 CSHACHVDEG-FQHFENMINHGIVPTVEHVNCLSELLSRSGCLKEAEKILQSMPASGDVA 41
C + ++ G + HF ++ G+ + N L + G L A+ + MP D+
Sbjct: 524 CKSSDSLELGKWVHF-LIMKAGLESDLHVSNALVSMFVNCGDLMSAKNLFNDMP-KRDLV 581

Query: 40 GWVSLLTACKAYG 2
W +++ +G
Sbjct: 582 SWNTIIAGFVQHG 594



Score = 91.3 bits (225), Expect = 4e-17
Identities = 54/200 (27%), Positives = 93/200 (46%)
Frame = -2

Query: 601 DTLEILELMQSRGMKADKVTLLSCAMACGSMGAFEQGKLIHELIVRDAFESDILVGTTLV 422
+ L + + G+K + T S C S + E GK +H LI++ ESD+ V LV
Sbjct: 497 NALATFQALLKEGIKPNSSTFTSILNVCKSSDSLELGKWVHFLIMKAGLESDLHVSNALV 556

Query: 421 DMYSKFGSLDEASNVFNRLANPHVVSWTALIVGYAQQGKISDALKCMKELEKRGLQPDGK 242
M+ G L A N+FN + +VSW +I G+ Q GK A K +++ G++PD
Sbjct: 557 SMFVNCGDLMSAKNLFNDMPKRDLVSWNTIIAGFVQHGKNQVAFDYFKMMQESGIKPDKI 616

Query: 241 IYVTLFMACSHACHVDEGFQHFENMINHGIVPTVEHVNCLSELLSRSGCLKEAEKILQSM 62
+ L AC+ + EG + + V L + ++ G +++A ++ +
Sbjct: 617 TFTGLLNACASPEALTEGRRLHALITEAAFDCDVLVGTGLISMYTKCGSIEDAHQVFHKL 676

Query: 61 PASGDVAGWVSLLTACKAYG 2
P +V W S++T +G
Sbjct: 677 PKK-NVYSWTSMITGYAQHG 695



Score = 88.6 bits (218), Expect = 3e-16
Identities = 48/200 (24%), Positives = 101/200 (50%)
Frame = -2

Query: 601 DTLEILELMQSRGMKADKVTLLSCAMACGSMGAFEQGKLIHELIVRDAFESDILVGTTLV 422
+ +++LE + S ++ + T + C G+ I+ I + + DI + TL+
Sbjct: 93 EAMQVLERVDSSHIQIYRQTYSALLQLCIKFKNLGDGERIYNHIKKSGVQPDIFMWNTLI 152

Query: 421 DMYSKFGSLDEASNVFNRLANPHVVSWTALIVGYAQQGKISDALKCMKELEKRGLQPDGK 242
+MY+K G+ A +F+ + V SW L+ GY Q G +A K +++ + ++PD +
Sbjct: 153 NMYAKCGNTISAKQIFDDMREKDVYSWNLLLGGYVQHGLYEEAFKLHEQMVQDSVKPDKR 212

Query: 241 IYVTLFMACSHACHVDEGFQHFENMINHGIVPTVEHVNCLSELLSRSGCLKEAEKILQSM 62
+V++ AC+ A +VD+G + + ++ G + L + + G + +A K+ ++
Sbjct: 213 TFVSMLNACADARNVDKGRELYNLILKAGWDTDLFVGTALINMHIKCGDIGDATKVFDNL 272

Query: 61 PASGDVAGWVSLLTACKAYG 2
P + D+ W S++T +G
Sbjct: 273 P-TRDLVTWTSMITGLARHG 291



Score = 37.0 bits (84), Expect = 0.94
Identities = 24/92 (26%), Positives = 40/92 (43%), Gaps = 1/92 (1%)
Frame = -2

Query: 601 DTLEILELMQSRGMKADKVTLLSCAMACGSMGAFEQGKLIHELIVRDAFESDILVGTTLV 422
+ LE+ MQ G+K D +T + AC G E+G + + E + +V
Sbjct: 699 EALELFYQMQQEGVKPDWITFVGALSACAHAGLIEEGLHHFQSMKEFNIEPRMEHYGCMV 758

Query: 421 DMYSKFGSLDEASN-VFNRLANPHVVSWTALI 329
D++ + G L+EA + P W AL+
Sbjct: 759 DLFGRAGLLNEAVEFIIKMQVEPDSRVWGALL 790


>tr|A9RJW2|A9RJW2_PHYPA Predicted protein OS=Physcomitrella patens
subsp. patens GN=PHYPADRAFT_175641 PE=4 SV=1
Length = 723

Score = 160 bits (404), Expect = 7e-38
Identities = 77/201 (38%), Positives = 131/201 (65%), Gaps = 2/201 (0%)
Frame = -2

Query: 601 DTLEILELMQSRGMKADKVTLLSCAMACGSMGAFEQGKLIHELIVRDAFESDILVGTTLV 422
+ + + MQ +G+K DK+T S +C S ++GK IH+ +V + D+ + + LV
Sbjct: 333 EAINLFRRMQQQGIKPDKMTFTSVLTSCSSPAFLQEGKRIHQQLVHAGYNLDVYLQSALV 392

Query: 421 DMYSKFGSLDEASNVFNRLANPHVVSWTALIVG-YAQQGKISDALKCMKELEKRGLQPDG 245
MY+K GS+D+AS VFN+++ +VV+WTA+I G AQ G+ +AL+ +++K+G++PD
Sbjct: 393 SMYAKCGSMDDASLVFNQMSERNVVAWTAIITGCCAQHGRCREALEYFDQMKKQGIKPDK 452

Query: 244 KIYVTLFMACSHACHVDEGFQHFENM-INHGIVPTVEHVNCLSELLSRSGCLKEAEKILQ 68
+ ++ AC+H V+EG +HF +M +++GI P VEH +C +LL R+G L+EAE ++
Sbjct: 453 VTFTSVLSACTHVGLVEEGRKHFRSMYLDYGIKPMVEHYSCFVDLLGRAGHLEEAENVIL 512

Query: 67 SMPASGDVAGWVSLLTACKAY 5
SMP + W +LL+AC+ +
Sbjct: 513 SMPFIPGPSVWGALLSACRVH 533



Score = 115 bits (289), Expect = 2e-24
Identities = 56/196 (28%), Positives = 107/196 (54%)
Frame = -2

Query: 595 LEILELMQSRGMKADKVTLLSCAMACGSMGAFEQGKLIHELIVRDAFESDILVGTTLVDM 416
LE+LE MQ + +K+T S C + A E GK +H I++ + ++ V +L+ M
Sbjct: 234 LELLETMQQAEVAPNKITFASILQGCTTPAALEHGKKVHRYIIQSGYGRELWVVNSLITM 293

Query: 415 YSKFGSLDEASNVFNRLANPHVVSWTALIVGYAQQGKISDALKCMKELEKRGLQPDGKIY 236
Y K G L+EA +F+ L + VV+WTA++ GYAQ G +A+ + ++++G++PD +
Sbjct: 294 YCKCGGLEEARKLFSDLPHRDVVTWTAMVTGYAQLGFHDEAINLFRRMQQQGIKPDKMTF 353

Query: 235 VTLFMACSHACHVDEGFQHFENMINHGIVPTVEHVNCLSELLSRSGCLKEAEKILQSMPA 56
++ +CS + EG + + +++ G V + L + ++ G + +A + M +
Sbjct: 354 TSVLTSCSSPAFLQEGKRIHQQLVHAGYNLDVYLQSALVSMYAKCGSMDDASLVFNQM-S 412

Query: 55 SGDVAGWVSLLTACKA 8
+V W +++T C A
Sbjct: 413 ERNVVAWTAIITGCCA 428



Score = 110 bits (274), Expect = 9e-23
Identities = 63/203 (31%), Positives = 107/203 (52%)
Frame = -2

Query: 610 KRLDTLEILELMQSRGMKADKVTLLSCAMACGSMGAFEQGKLIHELIVRDAFESDILVGT 431
K L+ + E M+ G K DKVT +S A + + G+ +H IV E + VGT
Sbjct: 128 KNLEAFKCYETMKLAGCKPDKVTFVSLLNAFTNPELLQLGQKVHMEIVEAGLELEPRVGT 187

Query: 430 TLVDMYSKFGSLDEASNVFNRLANPHVVSWTALIVGYAQQGKISDALKCMKELEKRGLQP 251
+LV MY+K G + +A +F+RL +VV+WT LI GYAQQG++ AL+ ++ +++ + P
Sbjct: 188 SLVGMYAKCGDISKARVIFDRLPEKNVVTWTLLIAGYAQQGQVDVALELLETMQQAEVAP 247

Query: 250 DGKIYVTLFMACSHACHVDEGFQHFENMINHGIVPTVEHVNCLSELLSRSGCLKEAEKIL 71
+ + ++ C+ ++ G + +I G + VN L + + G L+EA K+
Sbjct: 248 NKITFASILQGCTTPAALEHGKKVHRYIIQSGYGRELWVVNSLITMYCKCGGLEEARKLF 307

Query: 70 QSMPASGDVAGWVSLLTACKAYG 2
+P DV W +++T G
Sbjct: 308 SDLP-HRDVVTWTAMVTGYAQLG 329



Score = 78.6 bits (192), Expect = 3e-13
Identities = 48/200 (24%), Positives = 93/200 (46%)
Frame = -2

Query: 601 DTLEILELMQSRGMKADKVTLLSCAMACGSMGAFEQGKLIHELIVRDAFESDILVGTTLV 422
+ L I+ M +G + C + + EQG+ +H I++ + + + TL+
Sbjct: 30 EALGIMNTMILQGTRVYSDVFRGLLQECARLRSLEQGREVHAAILKSGIQPNRYLENTLL 89

Query: 421 DMYSKFGSLDEASNVFNRLANPHVVSWTALIVGYAQQGKISDALKCMKELEKRGLQPDGK 242
MY+K GSL +A VF+ + + ++VSWTA+I + K +A KC + ++ G +PD
Sbjct: 90 SMYAKCGSLTDARRVFDSIRDRNIVSWTAMIEAFVAGNKNLEAFKCYETMKLAGCKPDKV 149

Query: 241 IYVTLFMACSHACHVDEGFQHFENMINHGIVPTVEHVNCLSELLSRSGCLKEAEKILQSM 62
+V+L A ++ + G + ++ G+ L + ++ G + +A I +
Sbjct: 150 TFVSLLNAFTNPELLQLGQKVHMEIVEAGLELEPRVGTSLVGMYAKCGDISKARVIFDRL 209

Query: 61 PASGDVAGWVSLLTACKAYG 2
P +V W L+ G
Sbjct: 210 PEK-NVVTWTLLIAGYAQQG 228


>tr|Q7XUF2|Q7XUF2_ORYSJ Os04g0488200 protein OS=Oryza sativa subsp.
japonica GN=OJ991113_30.16 PE=4 SV=2
Length = 598

Score = 159 bits (402), Expect = 1e-37
Identities = 82/201 (40%), Positives = 122/201 (60%), Gaps = 1/201 (0%)
Frame = -2

Query: 601 DTLEILELMQSRGMKADKVTLLSCAMACGSMGAFEQGKLIHELIVRDAFESDILVGTTLV 422
+ LE+ MQ G+K DKV L + AC S+GA E G+ +HE I R E D+ VGT++V
Sbjct: 300 EALEVFNAMQISGVKPDKVVLSTVLSACASLGALESGRWVHEYIERKGIEWDVHVGTSVV 359

Query: 421 DMYSKFGSLDEASNVFNRLANPHVVSWTALIVGYAQQGKISDALKCMKELEKRGLQPDGK 242
DMY K G LD A ++F + +V SW ALI G+A G+ +AL C + GL P+
Sbjct: 360 DMYVKCGCLDTAVSIFQEMPLKNVSSWNALINGFALHGRGREALDCFDRMVASGLHPNEV 419

Query: 241 IYVTLFMACSHACHVDEGFQHFENMI-NHGIVPTVEHVNCLSELLSRSGCLKEAEKILQS 65
++T+ AC H+ V EG Q FE M ++ + P +H C+ +LL R+G ++EA ++++
Sbjct: 420 TFITVLGACCHSGLVQEGRQLFELMTKSYKLSPWEDHYGCMVDLLGRAGLIQEAYDVIKA 479

Query: 64 MPASGDVAGWVSLLTACKAYG 2
MP V WV+LL+AC+A+G
Sbjct: 480 MPMRPGVFTWVTLLSACQAHG 500



Score = 101 bits (251), Expect = 4e-20
Identities = 61/198 (30%), Positives = 100/198 (50%)
Frame = -2

Query: 595 LEILELMQSRGMKADKVTLLSCAMACGSMGAFEQGKLIHELIVRDAFESDILVGTTLVDM 416
+E L ++ + ++VTL S +ACG++G GK +H R E +++VG L+DM
Sbjct: 201 MEALGVLAEMDVTPNEVTLASVLVACGNLGTARAGKAVHGWYFRREKELNLIVGNALLDM 260

Query: 415 YSKFGSLDEASNVFNRLANPHVVSWTALIVGYAQQGKISDALKCMKELEKRGLQPDGKIY 236
Y K LD A VF+ L +VSWT +I G Q + S+AL+ ++ G++PD +
Sbjct: 261 YVKCEKLDLARRVFDMLLARDIVSWTVMISGLVQCKRPSEALEVFNAMQISGVKPDKVVL 320

Query: 235 VTLFMACSHACHVDEGFQHFENMINHGIVPTVEHVNCLSELLSRSGCLKEAEKILQSMPA 56
T+ AC+ ++ G E + GI V + ++ + GCL A I Q MP
Sbjct: 321 STVLSACASLGALESGRWVHEYIERKGIEWDVHVGTSVVDMYVKCGCLDTAVSIFQEMPL 380

Query: 55 SGDVAGWVSLLTACKAYG 2
+V+ W +L+ +G
Sbjct: 381 K-NVSSWNALINGFALHG 397



Score = 54.7 bits (130), Expect = 4e-06
Identities = 33/120 (27%), Positives = 56/120 (46%), Gaps = 1/120 (0%)
Frame = -2

Query: 565 GMKADKVTLLSCAMACGSMGA-FEQGKLIHELIVRDAFESDILVGTTLVDMYSKFGSLDE 389
G + D TL + AC +G +G H + + F + V LV Y G +
Sbjct: 112 GARPDGYTLPAALKACARLGGGLREGCQAHAVAEKAGFLGRVPVQNALVTFYGACGQCGD 171

Query: 388 ASNVFNRLANPHVVSWTALIVGYAQQGKISDALKCMKELEKRGLQPDGKIYVTLFMACSH 209
A VF+ +A VVSWTAL+ + + G +AL + E++ + P+ ++ +AC +
Sbjct: 172 ARKVFDEMAERDVVSWTALLSAFTRGGMFMEALGVLAEMD---VTPNEVTLASVLVACGN 228


>tr|A5CBT0|A5CBT0_VITVI Putative uncharacterized protein OS=Vitis
vinifera GN=VITISV_030261 PE=4 SV=1
Length = 622

Score = 159 bits (402), Expect = 1e-37
Identities = 81/207 (39%), Positives = 122/207 (58%), Gaps = 1/207 (0%)
Frame = -2

Query: 619 GK*KRLDTLEILELMQSRGMKADKVTLLSCAMACGSMGAFEQGKLIHELIVRDAFESDIL 440
G K + L + MQ+ G+K D V L+S AC +G +QGK IH I + E D +
Sbjct: 227 GAGKPKEALNLFHRMQTAGIKLDNVALVSTLQACADLGVLDQGKWIHAYIKKHEIEIDPI 286

Query: 439 VGTTLVDMYSKFGSLDEASNVFNRLANPHVVSWTALIVGYAQQGKISDALKCMKELEKRG 260
+G L+DMY+K G L+EA VF ++ V WTA+I GYA G+ +AL+ +++ G
Sbjct: 287 LGCVLIDMYAKCGDLEEAIEVFRKMEEKGVSVWTAMISGYAIHGRGREALEWFMKMQTAG 346

Query: 259 LQPDGKIYVTLFMACSHACHVDEGFQHFENMIN-HGIVPTVEHVNCLSELLSRSGCLKEA 83
++P+ + + ACSHA V E FE+M HG P++EH C+ +LL R+G LKEA
Sbjct: 347 VEPNQMTFTGILTACSHAGLVHEAKLLFESMERIHGFKPSIEHYGCMVDLLGRAGLLKEA 406

Query: 82 EKILQSMPASGDVAGWVSLLTACKAYG 2
E+++++MP + A W +LL AC +G
Sbjct: 407 EELIENMPVKPNAAIWGALLNACHIHG 433



Score = 67.0 bits (162), Expect = 8e-10
Identities = 48/205 (23%), Positives = 89/205 (43%), Gaps = 31/205 (15%)
Frame = -2

Query: 523 ACGSMGAFEQGKLIHELIVRDAFESDILVGTTLVDMYSKFGSLDEAS------------- 383
AC SM A E+ + IH I++ F S+I +L+++YSK G + A
Sbjct: 127 ACSSMSASEETQQIHAHIIKMGFGSEIYTTNSLLNVYSKSGDIKSARLLFDQVDQRDTVS 186

Query: 382 ------------------NVFNRLANPHVVSWTALIVGYAQQGKISDALKCMKELEKRGL 257
+FN + +++SWT++I G GK +AL ++ G+
Sbjct: 187 WNSMIDGYTKCGEIEMAYEIFNHMPERNIISWTSMISGCVGAGKPKEALNLFHRMQTAGI 246

Query: 256 QPDGKIYVTLFMACSHACHVDEGFQHFENMINHGIVPTVEHVNCLSELLSRSGCLKEAEK 77
+ D V+ AC+ +D+G + H I L ++ ++ G L+EA +
Sbjct: 247 KLDNVALVSTLQACADLGVLDQGKWIHAYIKKHEIEIDPILGCVLIDMYAKCGDLEEAIE 306

Query: 76 ILQSMPASGDVAGWVSLLTACKAYG 2
+ + M G V+ W ++++ +G
Sbjct: 307 VFRKMEEKG-VSVWTAMISGYAIHG 330



Score = 48.9 bits (115), Expect = 2e-04
Identities = 33/127 (25%), Positives = 55/127 (43%)
Frame = -2

Query: 403 GSLDEASNVFNRLANPHVVSWTALIVGYAQQGKISDALKCMKELEKRGLQPDGKIYVTLF 224
GSL A VF+R+ P+ W +I GY+ + +AL + + + + L
Sbjct: 66 GSLAYARTVFDRIFRPNTFMWNTMIRGYSNSKEPEEALLLYHHMLYHSVPHNAYTFPFLL 125

Query: 223 MACSHACHVDEGFQHFENMINHGIVPTVEHVNCLSELLSRSGCLKEAEKILQSMPASGDV 44
ACS +E Q ++I G + N L + S+SG +K A ++L D
Sbjct: 126 KACSSMSASEETQQIHAHIIKMGFGSEIYTTNSLLNVYSKSGDIKSA-RLLFDQVDQRDT 184

Query: 43 AGWVSLL 23
W S++
Sbjct: 185 VSWNSMI 191


>tr|A2XUW3|A2XUW3_ORYSI Putative uncharacterized protein OS=Oryza
sativa subsp. indica GN=OsI_16400 PE=4 SV=1
Length = 598

Score = 159 bits (402), Expect = 1e-37
Identities = 82/201 (40%), Positives = 122/201 (60%), Gaps = 1/201 (0%)
Frame = -2

Query: 601 DTLEILELMQSRGMKADKVTLLSCAMACGSMGAFEQGKLIHELIVRDAFESDILVGTTLV 422
+ LE+ MQ G+K DKV L + AC S+GA E G+ +HE I R E D+ VGT++V
Sbjct: 300 EALEVFNAMQISGVKPDKVVLSTVLSACASLGALESGRWVHEYIERKGIEWDVHVGTSVV 359

Query: 421 DMYSKFGSLDEASNVFNRLANPHVVSWTALIVGYAQQGKISDALKCMKELEKRGLQPDGK 242
DMY K G LD A ++F + +V SW ALI G+A G+ +AL C + GL P+
Sbjct: 360 DMYVKCGCLDTAVSIFQEMPLKNVSSWNALINGFALHGRGREALDCFDRMVASGLHPNEV 419

Query: 241 IYVTLFMACSHACHVDEGFQHFENMI-NHGIVPTVEHVNCLSELLSRSGCLKEAEKILQS 65
++T+ AC H+ V EG Q FE M ++ + P +H C+ +LL R+G ++EA ++++
Sbjct: 420 TFITVLGACCHSGLVQEGRQLFELMTKSYKLSPWEDHYGCMVDLLGRAGLIQEAYDVIKA 479

Query: 64 MPASGDVAGWVSLLTACKAYG 2
MP V WV+LL+AC+A+G
Sbjct: 480 MPMRPGVFTWVTLLSACQAHG 500



Score = 101 bits (251), Expect = 4e-20
Identities = 61/198 (30%), Positives = 100/198 (50%)
Frame = -2

Query: 595 LEILELMQSRGMKADKVTLLSCAMACGSMGAFEQGKLIHELIVRDAFESDILVGTTLVDM 416
+E L ++ + ++VTL S +ACG++G GK +H R E +++VG L+DM
Sbjct: 201 MEALGVLAEMDVTPNEVTLASVLVACGNLGTARAGKAVHGWYFRREKELNLIVGNALLDM 260

Query: 415 YSKFGSLDEASNVFNRLANPHVVSWTALIVGYAQQGKISDALKCMKELEKRGLQPDGKIY 236
Y K LD A VF+ L +VSWT +I G Q + S+AL+ ++ G++PD +
Sbjct: 261 YVKCEKLDLARRVFDMLLARDIVSWTVMISGLVQCKRPSEALEVFNAMQISGVKPDKVVL 320

Query: 235 VTLFMACSHACHVDEGFQHFENMINHGIVPTVEHVNCLSELLSRSGCLKEAEKILQSMPA 56
T+ AC+ ++ G E + GI V + ++ + GCL A I Q MP
Sbjct: 321 STVLSACASLGALESGRWVHEYIERKGIEWDVHVGTSVVDMYVKCGCLDTAVSIFQEMPL 380

Query: 55 SGDVAGWVSLLTACKAYG 2
+V+ W +L+ +G
Sbjct: 381 K-NVSSWNALINGFALHG 397



Score = 54.7 bits (130), Expect = 4e-06
Identities = 33/120 (27%), Positives = 56/120 (46%), Gaps = 1/120 (0%)
Frame = -2

Query: 565 GMKADKVTLLSCAMACGSMGA-FEQGKLIHELIVRDAFESDILVGTTLVDMYSKFGSLDE 389
G + D TL + AC +G +G H + + F + V LV Y G +
Sbjct: 112 GARPDGYTLPAALKACARLGGGLREGCQAHAVAEKAGFLGRVPVQNALVTFYGACGQCGD 171

Query: 388 ASNVFNRLANPHVVSWTALIVGYAQQGKISDALKCMKELEKRGLQPDGKIYVTLFMACSH 209
A VF+ +A VVSWTAL+ + + G +AL + E++ + P+ ++ +AC +
Sbjct: 172 ARKVFDEMAERDVVSWTALLSAFTRGGMFMEALGVLAEMD---VTPNEVTLASVLVACGN 228


>tr|A7PRP0|A7PRP0_VITVI Chromosome chr14 scaffold_27, whole genome
shotgun sequence OS=Vitis vinifera GN=GSVIVT00022577001
PE=4 SV=1
Length = 745

Score = 159 bits (401), Expect = 2e-37
Identities = 81/201 (40%), Positives = 122/201 (60%), Gaps = 1/201 (0%)
Frame = -2

Query: 601 DTLEILELMQSRGMKADKVTLLSCAMACGSMGAFEQGKLIHELIVRDAFESDILVGTTLV 422
+TL + MQ ++ D+ L+S AC + A +QGK +H I ++ + ++++GTTL+
Sbjct: 356 ETLALFHEMQLGQIRPDETILVSVISACTHLAALDQGKWVHAYIRKNGLKVNVILGTTLL 415

Query: 421 DMYSKFGSLDEASNVFNRLANPHVVSWTALIVGYAQQGKISDALKCMKELEKRGLQPDGK 242
DMY K G ++ A VFN + V SW ALI+G A G + +L E++ G+ P+
Sbjct: 416 DMYMKCGCVENALEVFNGMEEKGVSSWNALIIGLAVNGLVERSLDMFSEMKNNGVIPNEI 475

Query: 241 IYVTLFMACSHACHVDEGFQHFENMI-NHGIVPTVEHVNCLSELLSRSGCLKEAEKILQS 65
++ + AC H VDEG HF +MI HGI P V+H C+ +LL R+G L EAEK+++S
Sbjct: 476 TFMGVLGACRHMGLVDEGRCHFASMIEKHGIEPNVKHYGCMVDLLGRAGLLNEAEKLIES 535

Query: 64 MPASGDVAGWVSLLTACKAYG 2
MP + DVA W +LL ACK +G
Sbjct: 536 MPMAPDVATWGALLGACKKHG 556



Score = 92.8 bits (229), Expect = 1e-17
Identities = 58/223 (26%), Positives = 103/223 (46%), Gaps = 31/223 (13%)
Frame = -2

Query: 577 MQSRGMKADKVTLLSCAMACGSMGAFEQGKLIHELIVRDAFESDILVGTTLVDMYS---- 410
M + GM+ D+V ++S AC + + GK+IH L++R ES + + L+ MYS
Sbjct: 232 MNANGMRLDEVVVVSVLSACAHLSIVKTGKMIHGLVIRMGIESYVNLQNALIHMYSGSGE 291

Query: 409 ---------------------------KFGSLDEASNVFNRLANPHVVSWTALIVGYAQQ 311
K GS+++A +F+ + +VSW+A+I GYAQ
Sbjct: 292 IMDAQKLFNGSHNLDQISWNSMISGCMKCGSVEKARALFDVMPEKDIVSWSAVISGYAQH 351

Query: 310 GKISDALKCMKELEKRGLQPDGKIYVTLFMACSHACHVDEGFQHFENMINHGIVPTVEHV 131
S+ L E++ ++PD I V++ AC+H +D+G + +G+ V
Sbjct: 352 DCFSETLALFHEMQLGQIRPDETILVSVISACTHLAALDQGKWVHAYIRKNGLKVNVILG 411

Query: 130 NCLSELLSRSGCLKEAEKILQSMPASGDVAGWVSLLTACKAYG 2
L ++ + GC++ A ++ M G V+ W +L+ G
Sbjct: 412 TTLLDMYMKCGCVENALEVFNGMEEKG-VSSWNALIIGLAVNG 453



Score = 76.6 bits (187), Expect = 1e-12
Identities = 52/184 (28%), Positives = 86/184 (46%)
Frame = -2

Query: 553 DKVTLLSCAMACGSMGAFEQGKLIHELIVRDAFESDILVGTTLVDMYSKFGSLDEASNVF 374
D V+ S G E+ KLI + + + +I+ +++ + K G + EA +F
Sbjct: 143 DSVSWNSILAGYVKKGDVEEAKLIFDQMP----QRNIVASNSMIVLLGKMGQVMEAWKLF 198

Query: 373 NRLANPHVVSWTALIVGYAQQGKISDALKCMKELEKRGLQPDGKIYVTLFMACSHACHVD 194
N + +VSW+ALI GY Q G +AL E+ G++ D + V++ AC+H V
Sbjct: 199 NEMDEKDMVSWSALISGYEQNGMYEEALVMFIEMNANGMRLDEVVVVSVLSACAHLSIVK 258

Query: 193 EGFQHFENMINHGIVPTVEHVNCLSELLSRSGCLKEAEKILQSMPASGDVAGWVSLLTAC 14
G +I GI V N L + S SG + +A+K+ + D W S+++ C
Sbjct: 259 TGKMIHGLVIRMGIESYVNLQNALIHMYSGSGEIMDAQKLFNG-SHNLDQISWNSMISGC 317

Query: 13 KAYG 2
G
Sbjct: 318 MKCG 321



Score = 63.9 bits (154), Expect = 7e-09
Identities = 50/197 (25%), Positives = 90/197 (45%), Gaps = 3/197 (1%)
Frame = -2

Query: 595 LEILELMQSRGMKADKVTLLSCAMACGSMGAFEQGKLIHELIVRDAFESDILVGTTLVDM 416
L + +LM + D T AC GK IH+ +++ F+SD+ V TL++M
Sbjct: 63 LLLYKLMVKNNVGPDNYTYPLVVQACAVRLLEFGGKEIHDHVLKVGFDSDVYVQNTLINM 122

Query: 415 YSKFGSLDEASNVFNRLANPHVVSWTALIVGYAQQGKISDALKCMKELEKRGLQPDGKIY 236
Y+ G++ +A +F+ VSW +++ GY ++G + +A ++ +R + +
Sbjct: 123 YAVCGNMRDARKLFDESPVLDSVSWNSILAGYVKKGDVEEAKLIFDQMPQRNIVASNSMI 182

Query: 235 VTLFMACSHACHVDEGFQHFENMINHGIVPTVEHVNCLSELLSRSGCLKEAEKILQSMPA 56
V L V E ++ F M +V + L ++G +EA + M A
Sbjct: 183 VLL----GKMGQVMEAWKLFNEMDEKDMVSW----SALISGYEQNGMYEEALVMFIEMNA 234

Query: 55 SG---DVAGWVSLLTAC 14
+G D VS+L+AC
Sbjct: 235 NGMRLDEVVVVSVLSAC 251



Score = 48.9 bits (115), Expect = 2e-04
Identities = 36/152 (23%), Positives = 63/152 (41%), Gaps = 2/152 (1%)
Frame = -2

Query: 472 IVRDAFESDILVGTTLVDMY--SKFGSLDEASNVFNRLANPHVVSWTALIVGYAQQGKIS 299
++ F SD + L+ S F LD + +F+R+ N + W ++ Y Q
Sbjct: 1 MILTGFISDTFAASRLLKFSTDSPFIGLDYSLQIFDRIENSNGFMWNTMMRAYIQSNSAE 60

Query: 298 DALKCMKELEKRGLQPDGKIYVTLFMACSHACHVDEGFQHFENMINHGIVPTVEHVNCLS 119
AL K + K + PD Y + AC+ G + ++++ G V N L
Sbjct: 61 KALLLYKLMVKNNVGPDNYTYPLVVQACAVRLLEFGGKEIHDHVLKVGFDSDVYVQNTLI 120

Query: 118 ELLSRSGCLKEAEKILQSMPASGDVAGWVSLL 23
+ + G +++A K+ P D W S+L
Sbjct: 121 NMYAVCGNMRDARKLFDESPVL-DSVSWNSIL 151


>tr|A7PNH6|A7PNH6_VITVI Chromosome chr1 scaffold_22, whole genome
shotgun sequence OS=Vitis vinifera GN=GSVIVT00021258001
PE=4 SV=1
Length = 563

Score = 158 bits (400), Expect = 2e-37
Identities = 79/201 (39%), Positives = 120/201 (59%), Gaps = 1/201 (0%)
Frame = -2

Query: 601 DTLEILELMQSRGMKADKVTLLSCAMACGSMGAFEQGKLIHELIVRDAFESDILVGTTLV 422
+ L + MQ+ G+K D V L+S AC +G +QGK IH I + E D ++G L+
Sbjct: 174 EALNLFHRMQTAGIKLDNVALVSTLQACADLGVLDQGKWIHAYIKKHEIEIDPILGCVLI 233

Query: 421 DMYSKFGSLDEASNVFNRLANPHVVSWTALIVGYAQQGKISDALKCMKELEKRGLQPDGK 242
DMY+K G L+EA VF ++ V WTA+I GYA G+ +AL+ +++ G++P+
Sbjct: 234 DMYAKCGDLEEAIEVFRKMEEKGVSVWTAMISGYAIHGRGREALEWFMKMQTAGVEPNQM 293

Query: 241 IYVTLFMACSHACHVDEGFQHFENMIN-HGIVPTVEHVNCLSELLSRSGCLKEAEKILQS 65
+ + ACSHA V E FE+M HG P++EH C+ +LL R+G LKEAE+++++
Sbjct: 294 TFTGILTACSHAGLVHEAKLLFESMERIHGFKPSIEHYGCMVDLLGRAGLLKEAEELIEN 353

Query: 64 MPASGDVAGWVSLLTACKAYG 2
MP + A W +LL AC +G
Sbjct: 354 MPVKPNAAIWGALLNACHIHG 374



Score = 47.0 bits (110), Expect = 0.001
Identities = 29/114 (25%), Positives = 50/114 (43%)
Frame = -2

Query: 403 GSLDEASNVFNRLANPHVVSWTALIVGYAQQGKISDALKCMKELEKRGLQPDGKIYVTLF 224
GSL A VF+R+ P+ W +I GY+ + +AL + + + + L
Sbjct: 55 GSLAYARTVFDRIFRPNTFMWNTMIRGYSNSKEPEEALLLYHHMLYHSVPHNAYTFPFLL 114

Query: 223 MACSHACHVDEGFQHFENMINHGIVPTVEHVNCLSELLSRSGCLKEAEKILQSM 62
ACS ++E Q ++I G + N L + S+SG +K A + +
Sbjct: 115 KACSSMSALEETQQIHAHIIKMGFGSEIYTTNSLLNVYSKSGDIKSARLLFDQV 168


>tr|A9T8E9|A9T8E9_PHYPA Predicted protein OS=Physcomitrella patens
subsp. patens GN=PHYPADRAFT_192620 PE=4 SV=1
Length = 902

Score = 157 bits (398), Expect = 4e-37
Identities = 78/201 (38%), Positives = 126/201 (62%), Gaps = 1/201 (0%)
Frame = -2

Query: 601 DTLEILELMQSRGMKADKVTLLSCAMACGSMGAFEQGKLIHELIVRDAFESDILVGTTLV 422
+ L++ + +Q G+K DKVT ++ AC + G+ E + IH L+ + F SD VG LV
Sbjct: 513 EALKLFDRLQEEGLKPDKVTYINMLNACANSGSLEWAREIHTLVRKGGFFSDTSVGNALV 572

Query: 421 DMYSKFGSLDEASNVFNRLANPHVVSWTALIVGYAQQGKISDALKCMKELEKRGLQPDGK 242
Y+K GS +AS VF ++ +V+SW A+I G AQ G+ DAL+ + ++ G++PD
Sbjct: 573 STYAKCGSFSDASIVFEKMTKRNVISWNAIIGGSAQHGRGQDALQLFERMKMEGVKPDIV 632

Query: 241 IYVTLFMACSHACHVDEGFQHFENMI-NHGIVPTVEHVNCLSELLSRSGCLKEAEKILQS 65
+V+L ACSHA ++EG ++F +M + I+PT+EH C+ +LL R+G L EAE ++++
Sbjct: 633 TFVSLLSACSHAGLLEEGRRYFCSMSQDFAIIPTIEHYGCMVDLLGRAGQLDEAEALIKT 692

Query: 64 MPASGDVAGWVSLLTACKAYG 2
MP + W +LL AC+ +G
Sbjct: 693 MPFQANTRIWGALLGACRIHG 713



Score = 104 bits (259), Expect = 5e-21
Identities = 54/177 (30%), Positives = 95/177 (53%)
Frame = -2

Query: 592 EILELMQSRGMKADKVTLLSCAMACGSMGAFEQGKLIHELIVRDAFESDILVGTTLVDMY 413
E+ MQ G+ +K+T + AC + A GK IH + + F SDI V L+ MY
Sbjct: 314 EVYNQMQREGVMPNKITYVILLNACVNSAALHWGKEIHSRVAKAGFTSDIGVQNALISMY 373

Query: 412 SKFGSLDEASNVFNRLANPHVVSWTALIVGYAQQGKISDALKCMKELEKRGLQPDGKIYV 233
S+ GS+ +A VF+++ V+SWTA+I G A+ G ++AL +E+++ G++P+ Y
Sbjct: 374 SRCGSIKDARLVFDKMVRKDVISWTAMIGGLAKSGFGAEALTVYQEMQQAGVEPNRVTYT 433

Query: 232 TLFMACSHACHVDEGFQHFENMINHGIVPTVEHVNCLSELLSRSGCLKEAEKILQSM 62
++ ACS ++ G + + ++ G+ N L + S G +K+A ++ M
Sbjct: 434 SILNACSSPAALEWGRRIHQQVVEAGLATDAHVGNTLVNMYSMCGSVKDARQVFDRM 490



Score = 103 bits (258), Expect = 6e-21
Identities = 56/190 (29%), Positives = 95/190 (50%)
Frame = -2

Query: 592 EILELMQSRGMKADKVTLLSCAMACGSMGAFEQGKLIHELIVRDAFESDILVGTTLVDMY 413
EI + M+ G+ +++T +S A S A + GK +H I+ ESD VGT LV MY
Sbjct: 213 EIFQKMEQEGVVPNRITYISVLNAFSSPAALKWGKAVHSRILNAGHESDTAVGTALVKMY 272

Query: 412 SKFGSLDEASNVFNRLANPHVVSWTALIVGYAQQGKISDALKCMKELEKRGLQPDGKIYV 233
+K GS + VF +L N +++W +I G A+ G +A + ++++ G+ P+ YV
Sbjct: 273 AKCGSYKDCRQVFEKLVNRDLIAWNTMIGGLAEGGYWEEASEVYNQMQREGVMPNKITYV 332

Query: 232 TLFMACSHACHVDEGFQHFENMINHGIVPTVEHVNCLSELLSRSGCLKEAEKILQSMPAS 53
L AC ++ + G + + G + N L + SR G +K+A + M
Sbjct: 333 ILLNACVNSAALHWGKEIHSRVAKAGFTSDIGVQNALISMYSRCGSIKDARLVFDKM-VR 391

Query: 52 GDVAGWVSLL 23
DV W +++
Sbjct: 392 KDVISWTAMI 401



Score = 100 bits (249), Expect = 7e-20
Identities = 57/200 (28%), Positives = 100/200 (50%)
Frame = -2

Query: 601 DTLEILELMQSRGMKADKVTLLSCAMACGSMGAFEQGKLIHELIVRDAFESDILVGTTLV 422
+ L + + MQ G++ ++VT S AC S A E G+ IH+ +V +D VG TLV
Sbjct: 412 EALTVYQEMQQAGVEPNRVTYTSILNACSSPAALEWGRRIHQQVVEAGLATDAHVGNTLV 471

Query: 421 DMYSKFGSLDEASNVFNRLANPHVVSWTALIVGYAQQGKISDALKCMKELEKRGLQPDGK 242
+MYS GS+ +A VF+R+ +V++ A+I GYA +ALK L++ GL+PD
Sbjct: 472 NMYSMCGSVKDARQVFDRMIQRDIVAYNAMIGGYAAHNLGKEALKLFDRLQEEGLKPDKV 531

Query: 241 IYVTLFMACSHACHVDEGFQHFENMINHGIVPTVEHVNCLSELLSRSGCLKEAEKILQSM 62
Y+ + AC+++ ++ + + G N L ++ G +A + + M
Sbjct: 532 TYINMLNACANSGSLEWAREIHTLVRKGGFFSDTSVGNALVSTYAKCGSFSDASIVFEKM 591

Query: 61 PASGDVAGWVSLLTACKAYG 2
+V W +++ +G
Sbjct: 592 -TKRNVISWNAIIGGSAQHG 610



Score = 96.7 bits (239), Expect = 1e-18
Identities = 52/191 (27%), Positives = 100/191 (52%)
Frame = -2

Query: 595 LEILELMQSRGMKADKVTLLSCAMACGSMGAFEQGKLIHELIVRDAFESDILVGTTLVDM 416
L++L MQ G+ D+ T++S +C S GA E G+ IH ++ D+ V +++M
Sbjct: 111 LKLLRQMQQHGLAPDRTTIMSFLSSCKSPGALEWGREIHFQAMQAGLLFDVKVANCILNM 170

Query: 415 YSKFGSLDEASNVFNRLANPHVVSWTALIVGYAQQGKISDALKCMKELEKRGLQPDGKIY 236
Y+K GS++EA VF+++ VVSWT I GYA G+ A + +++E+ G+ P+ Y
Sbjct: 171 YAKCGSIEEAREVFDKMEKKSVVSWTITIGGYADCGRSETAFEIFQKMEQEGVVPNRITY 230

Query: 235 VTLFMACSHACHVDEGFQHFENMINHGIVPTVEHVNCLSELLSRSGCLKEAEKILQSMPA 56
+++ A S + G ++N G L ++ ++ G K+ ++ + +
Sbjct: 231 ISVLNAFSSPAALKWGKAVHSRILNAGHESDTAVGTALVKMYAKCGSYKDCRQVFEKL-V 289

Query: 55 SGDVAGWVSLL 23
+ D+ W +++
Sbjct: 290 NRDLIAWNTMI 300



Score = 86.3 bits (212), Expect = 1e-15
Identities = 47/193 (24%), Positives = 101/193 (52%), Gaps = 3/193 (1%)
Frame = -2

Query: 595 LEILELMQSRGMKADKVTLLSCAMACGSMGAFEQGKLIHELIVRDAFESDILVGTTLVDM 416
+++++ +Q +G + + + C + G+ +H+ I++ D L++M
Sbjct: 8 VDVVQYLQQQGAQVNSSDYMKMLKRCIEVKDLVAGRQVHQHIIQHRTVPDQYTVNALINM 67

Query: 415 YSKFGSLDEASNVFNRLANPH--VVSWTALIVGYAQQGKISDALKCMKELEKRGLQPDGK 242
Y + GS++EA V+ +L+ V SW A++VGY Q G I ALK ++++++ GL PD
Sbjct: 68 YIQCGSIEEARQVWKKLSYMERTVHSWNAMVVGYIQYGYIEKALKLLRQMQQHGLAPDRT 127

Query: 241 IYVTLFMACSHACHVDEGFQ-HFENMINHGIVPTVEHVNCLSELLSRSGCLKEAEKILQS 65
++ +C ++ G + HF+ M G++ V+ NC+ + ++ G ++EA ++
Sbjct: 128 TIMSFLSSCKSPGALEWGREIHFQAM-QAGLLFDVKVANCILNMYAKCGSIEEAREVFDK 186

Query: 64 MPASGDVAGWVSL 26
M V+ +++
Sbjct: 187 MEKKSVVSWTITI 199