BP918471
Clone id YMU001_000113_H03
Library
Length 275
Definition Adiantum capillus-veneris mRNA. clone: YMU001_000113_H03.
Accession
Tissue type prothallium
Developmental stage -
Contig ID -
Sequence
ATTCCTGAAGCTTTAGAGCCGCATTCCTCATACAAGGATTGTACATCCATATCCATATCA
AGAGGTAGATTGTCTAACCAAATGTCCTTTATAGGAGTTGACTTCAGAGTTAGGCTCCTA
TCATTAATCTCTCTAACTTTTTCCCATAAGTATCCTGGTCAGTCTTCTTCTACGAATGGA
ATTCCCTCTTAAGGCATCTTCACTGTCAGGCTCTATGACTTCTGGTTCTTTAGTTTCAAG
GTGTGATTTACCACCACTTTGGATTTCTCTTTACT
■■Homology search results ■■ -
sp_hit_id P53914
Definition sp|P53914|YNN2_YEAST UPF0202 protein YNL132W OS=Saccharomyces cerevisiae
Align length 38
Score (bit) 31.2
E-value 1.7
Report
BLASTX 2.2.19 [Nov-02-2008]


Reference: Altschul, Stephen F., Thomas L. Madden, Alejandro A. Schaffer,
Jinghui Zhang, Zheng Zhang, Webb Miller, and David J. Lipman (1997),
"Gapped BLAST and PSI-BLAST: a new generation of protein database search
programs", Nucleic Acids Res. 25:3389-3402.

Query= BP918471|Adiantum capillus-veneris mRNA, clone:
YMU001_000113_H03.
(256 letters)

Database: uniprot_sprot.fasta
412,525 sequences; 148,809,765 total letters

Searching..................................................done



Score E
Sequences producing significant alignments: (bits) Value

sp|P53914|YNN2_YEAST UPF0202 protein YNL132W OS=Saccharomyces ce... 31 1.7

>sp|P53914|YNN2_YEAST UPF0202 protein YNL132W OS=Saccharomyces
cerevisiae GN=YNL132W PE=1 SV=1
Length = 1056

Score = 31.2 bits (69), Expect = 1.7
Identities = 16/38 (42%), Positives = 22/38 (57%)
Frame = +3

Query: 21 CTSISISRGRLSNQMSFIGVDFRVRLLSLISLTFSHKY 134
C +++ GR SN + DFR R LSL+S F HK+
Sbjct: 760 CVMLNVLEGRESNWLVEFAKDFRKRFLSLLSYDF-HKF 796


tr_hit_id -
Definition No hits.
Align length -
Score (bit) -
E-value -
Report
BLASTX 2.2.19 [Nov-02-2008]


Reference: Altschul, Stephen F., Thomas L. Madden, Alejandro A. Schaffer,
Jinghui Zhang, Zheng Zhang, Webb Miller, and David J. Lipman (1997),
"Gapped BLAST and PSI-BLAST: a new generation of protein database search
programs", Nucleic Acids Res. 25:3389-3402.

Query= BP918471|Adiantum capillus-veneris mRNA, clone:
YMU001_000113_H03.
(256 letters)

Database: uniprot_trembl.fasta
7,341,751 sequences; 2,391,615,440 total letters

Searching..................................................done

***** No hits found ******