BP918495
Clone id YMU001_000114_B08
Library
Length 414
Definition Adiantum capillus-veneris mRNA. clone: YMU001_000114_B08.
Accession
Tissue type prothallium
Developmental stage -
Contig ID -
Sequence
TCTGTCAATGCCTCTTCTTCTCTTCTCTGCAACCTGACTGACTCGTAGCATTGCTCATCT
ACACCCAGTGCGTTATATACCCCTGCGGTAGACAACTTCTGGCTGTTTGAAACAAATACT
TGAGCTCCGTGACTATCATAGCTTCCTTGAGTCGCATTCAGATGACTTGGGAGATTGTTA
CCATGCATATGATCTCCCAACGCATCATTCAATGGCTCATATTCACCTCTTCCATGACCC
ACACTATTGAATGATGCCATACCATAATGGTGCTTTGTCATGTCCATTCCAAGCCTAGCA
TCTTCAGAAGTTCCATAATATTCACTTCTAAAACCTCTTTCAAACCTGTTTTCTGGAATC
CTAATATTTGCATCAACTCTTGGCGGTTCAGCTGCATGCAACCTTGGCAGAAAG
■■Homology search results ■■ -
sp_hit_id P07183
Definition sp|P07183|CH38_DROME Chorion protein S38 OS=Drosophila melanogaster
Align length 107
Score (bit) 34.3
E-value 0.2
Report
BLASTX 2.2.19 [Nov-02-2008]


Reference: Altschul, Stephen F., Thomas L. Madden, Alejandro A. Schaffer,
Jinghui Zhang, Zheng Zhang, Webb Miller, and David J. Lipman (1997),
"Gapped BLAST and PSI-BLAST: a new generation of protein database search
programs", Nucleic Acids Res. 25:3389-3402.

Query= BP918495|Adiantum capillus-veneris mRNA, clone:
YMU001_000114_B08.
(414 letters)

Database: uniprot_sprot.fasta
412,525 sequences; 148,809,765 total letters

Searching..................................................done



Score E
Sequences producing significant alignments: (bits) Value

sp|P07183|CH38_DROME Chorion protein S38 OS=Drosophila melanogas... 34 0.20
sp|Q95RC0|MAK3_DROME N-acetyltransferase MAK3 homolog OS=Drosoph... 33 0.34
sp|A9KRZ3|EFG_CLOPH Elongation factor G OS=Clostridium phytoferm... 30 3.8
sp|Q86HL1|Y7751_DICDI Putative uncharacterized protein DDB_G0274... 30 4.9
sp|O18531|ECR_LUCCU Ecdysone receptor OS=Lucilia cuprina GN=EcR ... 30 4.9
sp|Q802V6|ABH2A_DANRE Abhydrolase domain-containing protein 2-A ... 30 4.9
sp|Q54UK3|Y3961_DICDI Uncharacterized protein DDB_G0281025 OS=Di... 29 6.5
sp|Q3UHC0|TNR6C_MOUSE Trinucleotide repeat-containing gene 6C pr... 29 6.5

>sp|P07183|CH38_DROME Chorion protein S38 OS=Drosophila melanogaster
GN=Cp38 PE=1 SV=1
Length = 306

Score = 34.3 bits (77), Expect = 0.20
Identities = 29/107 (27%), Positives = 45/107 (42%), Gaps = 1/107 (0%)
Frame = -2

Query: 407 PRLHAAEPPRVDANIRIPENRFERGFRSEYYGT-SEDARLGMDMTKHHYGMASFNSVGHG 231
PR EP V+ ++ P ++ + YG S+ G H +G + GHG
Sbjct: 169 PRRVKVEPVFVNV-VKPPAEKYFVNENKQGYGQGSQSHGHGHGHGGHGHGHSGHGHGGHG 227

Query: 230 RGEYEPLNDALGDHMHGNNLPSHLNATQGSYDSHGAQVFVSNSQKLS 90
G + P G H G LP++ + + S G Q+ S +Q LS
Sbjct: 228 AGPHGP-----GPHDGGRALPAYASGADSAAASAGYQLLQSGNQGLS 269


>sp|Q95RC0|MAK3_DROME N-acetyltransferase MAK3 homolog OS=Drosophila
melanogaster GN=CG11412 PE=1 SV=1
Length = 377

Score = 33.5 bits (75), Expect = 0.34
Identities = 13/42 (30%), Positives = 23/42 (54%)
Frame = -2

Query: 248 NSVGHGRGEYEPLNDALGDHMHGNNLPSHLNATQGSYDSHGA 123
N GH E PL + + H HG++ +H+ T GS +++ +
Sbjct: 73 NGHGHKEQEARPLGEVVNGHAHGHSNNNHIRCTSGSSNNNNS 114


>sp|A9KRZ3|EFG_CLOPH Elongation factor G OS=Clostridium
phytofermentans (strain ATCC 700394 / DSM 18823 / ISDg)
GN=fusA PE=3 SV=1
Length = 705

Score = 30.0 bits (66), Expect = 3.8
Identities = 23/114 (20%), Positives = 48/114 (42%), Gaps = 1/114 (0%)
Frame = -2

Query: 380 RVDANIRIPENRFERGFRSEYYGTSEDARLGMDMTKHHYGMASFNSVG-HGRGEYEPLND 204
+V+AN+ P+ ++ GF E S+ A+ ++ + F+ + +G +E ++
Sbjct: 481 KVEANVGAPQVAYKEGFTKEVDIDSKYAKQSGGRGQYGHCKVKFSPMDVNGEKVFEFVST 540

Query: 203 ALGDHMHGNNLPSHLNATQGSYDSHGAQVFVSNSQKLSTAGVYNALGVDEQCYE 42
+G + +P+ Q + ++ K G Y LGV CY+
Sbjct: 541 VVGGAIPKEYIPA-------------VQAGIEDAMKCGVLGGYPVLGVRANCYD 581


>sp|Q86HL1|Y7751_DICDI Putative uncharacterized protein DDB_G0274535
OS=Dictyostelium discoideum GN=DDB_G0274535 PE=4 SV=1
Length = 455

Score = 29.6 bits (65), Expect = 4.9
Identities = 23/89 (25%), Positives = 41/89 (46%), Gaps = 5/89 (5%)
Frame = -2

Query: 254 SFNSVGHGRGEYEPLNDALGDHMHGNNLPSHLNATQGSYDSHGAQVFVSNSQK-----LS 90
SFN+ +G N+ +H++ NN +H N + +++ V N QK L+
Sbjct: 214 SFNTTVNG-------NNVNSNHINNNN--NHNNNNNNNNNNNNNNNIVYNIQKQSFNKLN 264

Query: 89 TAGVYNALGVDEQCYESVRLQRREEEALT 3
+G DE+C E + Q+++ E T
Sbjct: 265 GSGSSEIFQFDEECEEELEEQQKQNENKT 293


>sp|O18531|ECR_LUCCU Ecdysone receptor OS=Lucilia cuprina GN=EcR
PE=2 SV=2
Length = 757

Score = 29.6 bits (65), Expect = 4.9
Identities = 19/74 (25%), Positives = 33/74 (44%), Gaps = 8/74 (10%)
Frame = -2

Query: 263 GMASFNSVGHGRGEYEPLNDALGDHMHGNNLPSHLNATQGSYDSH--------GAQVFVS 108
GM S N +G G G ++ +H+H N+ +H N++ + H G V ++
Sbjct: 139 GMTSLNGLGGGGGSQVNNHNHSHNHLHHNSNSNHSNSSSHHTNGHMGIGGGGGGLSVNIN 198

Query: 107 NSQKLSTAGVYNAL 66
+S A N+L
Sbjct: 199 GPNIVSNAQQLNSL 212


>sp|Q802V6|ABH2A_DANRE Abhydrolase domain-containing protein 2-A
OS=Danio rerio GN=abhd2a PE=2 SV=1
Length = 432

Score = 29.6 bits (65), Expect = 4.9
Identities = 23/91 (25%), Positives = 41/91 (45%), Gaps = 2/91 (2%)
Frame = -2

Query: 329 RSEYYGTSEDARLGMDMTKHHYGMASFNSVGHGRGEYEPLNDALGDHMHGNNLPSHLNAT 150
+S + T+ +LG + H +G+ + + G L + L DH G ++ +
Sbjct: 79 KSGHLQTALYGKLGRVSSPHPFGLRKYLPMQDGATATFDLFEPLADHQSGEDVTMVICPG 138

Query: 149 QGSY-DSHGAQVFVSNSQKLS-TAGVYNALG 63
G++ + H + FV +SQK V N LG
Sbjct: 139 IGNHSEKHYIRTFVDHSQKQGYRCAVLNHLG 169


>sp|Q54UK3|Y3961_DICDI Uncharacterized protein DDB_G0281025
OS=Dictyostelium discoideum GN=DDB_G0281025 PE=4 SV=1
Length = 880

Score = 29.3 bits (64), Expect = 6.5
Identities = 13/36 (36%), Positives = 19/36 (52%)
Frame = +3

Query: 306 RSSIIFTSKTSFKPVFWNPNICINSWRFSCMQPWQK 413
+S+I+FT +K W PNIC+ +C P K
Sbjct: 155 KSTIVFTECLEYKGHQWRPNICV-----TCFSPKNK 185


>sp|Q3UHC0|TNR6C_MOUSE Trinucleotide repeat-containing gene 6C
protein OS=Mus musculus GN=Tnrc6c PE=1 SV=2
Length = 1690

Score = 29.3 bits (64), Expect = 6.5
Identities = 15/39 (38%), Positives = 22/39 (56%)
Frame = -2

Query: 179 NNLPSHLNATQGSYDSHGAQVFVSNSQKLSTAGVYNALG 63
++ PSHL T GS+ ++GA V ++Q AG N G
Sbjct: 8 SSFPSHLKKTNGSHGTNGALVQSPSNQSALGAGGTNGNG 46


tr_hit_id Q7QI37
Definition tr|Q7QI37|Q7QI37_ANOGA C-type lectin, selectin-like (AGAP000929-PA) (Fragment) OS=Anopheles gambiae
Align length 92
Score (bit) 37.7
E-value 0.29
Report
BLASTX 2.2.19 [Nov-02-2008]


Reference: Altschul, Stephen F., Thomas L. Madden, Alejandro A. Schaffer,
Jinghui Zhang, Zheng Zhang, Webb Miller, and David J. Lipman (1997),
"Gapped BLAST and PSI-BLAST: a new generation of protein database search
programs", Nucleic Acids Res. 25:3389-3402.

Query= BP918495|Adiantum capillus-veneris mRNA, clone:
YMU001_000114_B08.
(414 letters)

Database: uniprot_trembl.fasta
7,341,751 sequences; 2,391,615,440 total letters

Searching..................................................done



Score E
Sequences producing significant alignments: (bits) Value

tr|Q7QI37|Q7QI37_ANOGA C-type lectin, selectin-like (AGAP000929-... 38 0.29
tr|A7TGI1|A7TGI1_VANPO Putative uncharacterized protein OS=Vande... 36 0.84
tr|B4IJX3|B4IJX3_DROSE GM21647 OS=Drosophila sechellia GN=GM2164... 35 1.9
tr|B3P3E1|B3P3E1_DROER GG22224 OS=Drosophila erecta GN=GG22224 P... 35 1.9
tr|A4ULZ0|A4ULZ0_DROSE Chorion protein 38 (Fragment) OS=Drosophi... 35 1.9
tr|Q7RIQ7|Q7RIQ7_PLAYO Putative uncharacterized protein PY03560 ... 35 2.4
tr|B3DNM9|B3DNM9_DROME TA01446p (Fragment) OS=Drosophila melanog... 34 3.2
tr|B3DNC0|B3DNC0_DROME IP19609p (Fragment) OS=Drosophila melanog... 34 3.2
tr|B3DNA9|B3DNA9_DROME IP19109p (IP19503p) (Fragment) OS=Drosoph... 34 3.2
tr|A4ULY9|A4ULY9_DROSI Chorion protein 38 (Fragment) OS=Drosophi... 34 3.2
tr|B4Q0A7|B4Q0A7_DROYA GE15787 OS=Drosophila yakuba GN=GE15787 P... 34 4.2
tr|A4ULZ4|A4ULZ4_DROTE Chorion protein 38 (Fragment) OS=Drosophi... 34 4.2
tr|A4ULZ3|A4ULZ3_9MUSC Chorion protein 38 (Fragment) OS=Drosophi... 34 4.2
tr|A4ULZ2|A4ULZ2_DROYA Chorion protein 38 (Fragment) OS=Drosophi... 34 4.2
tr|Q29HI0|Q29HI0_DROPS GA10847 OS=Drosophila pseudoobscura pseud... 33 7.1
tr|B4GXM4|B4GXM4_DROPE GL20318 OS=Drosophila persimilis GN=GL203... 33 7.1
tr|B3NVH0|B3NVH0_DROER GG18257 OS=Drosophila erecta GN=GG18257 P... 33 7.1

>tr|Q7QI37|Q7QI37_ANOGA C-type lectin, selectin-like (AGAP000929-PA)
(Fragment) OS=Anopheles gambiae GN=CTLSE1 PE=4 SV=3
Length = 1135

Score = 37.7 bits (86), Expect = 0.29
Identities = 26/92 (28%), Positives = 43/92 (46%), Gaps = 1/92 (1%)
Frame = -2

Query: 413 FLPRLHAAEPPRVDANIRIPENRFERGFRSEYYGTSEDARLGMDMTKHHYGMASFNSVGH 234
FL R + A P + N++ E++ ++ Y + E+ R D+T G+ +FN+
Sbjct: 996 FLHR-NKARPVKNTENVQAAEHKEDQNAAVMSYSSLENGRHNFDLTNRGGGLVTFNTFHQ 1054

Query: 233 -GRGEYEPLNDALGDHMHGNNLPSHLNATQGS 141
G G + P L H + N+L S N T S
Sbjct: 1055 SGAGHHPPPPSQLTHHNNNNHLSSSNNNTASS 1086


>tr|A7TGI1|A7TGI1_VANPO Putative uncharacterized protein
OS=Vanderwaltozyma polyspora (strain ATCC 22028 / DSM
70294) GN=Kpol_1048p18 PE=4 SV=1
Length = 1074

Score = 36.2 bits (82), Expect = 0.84
Identities = 28/117 (23%), Positives = 49/117 (41%), Gaps = 2/117 (1%)
Frame = -2

Query: 350 NRFERGFRSEYYGTSEDARLGMDMTKHHYGMASFNSVGHGRGEYEPLNDALGDHMHGNNL 171
N+ +R + ++Y G + D + HYG S+NS G G Y + MH NN
Sbjct: 22 NQQQRPYANQYNGRRNNYDFYNDHRQGHYGGHSYNSSYGGNG-YPYRHGMSNSPMHSNNS 80

Query: 170 PSHLNATQGSYDSHGAQVF--VSNSQKLSTAGVYNALGVDEQCYESVRLQRREEEAL 6
+ N+ + +++ N + + YN++G D + Y V +E L
Sbjct: 81 SNSSNSNNNNNNNNNINNIHNTDNGGAMDSNDYYNSIG-DIRSYSGVSRNNESKEFL 136


>tr|B4IJX3|B4IJX3_DROSE GM21647 OS=Drosophila sechellia GN=GM21647
PE=4 SV=1
Length = 214

Score = 35.0 bits (79), Expect = 1.9
Identities = 29/107 (27%), Positives = 45/107 (42%), Gaps = 1/107 (0%)
Frame = -2

Query: 407 PRLHAAEPPRVDANIRIPENRFERGFRSEYYGT-SEDARLGMDMTKHHYGMASFNSVGHG 231
PR EP V+ ++ P ++ + YG S+ G H +G + GHG
Sbjct: 77 PRRFRFEPVFVNV-VKPPAEKYFVNENKQGYGQGSQSHGHGHGHGGHGHGHSGHGHGGHG 135

Query: 230 RGEYEPLNDALGDHMHGNNLPSHLNATQGSYDSHGAQVFVSNSQKLS 90
G + P G H G LP++ + + S G Q+ S +Q LS
Sbjct: 136 AGPHGP-----GPHDGGRGLPAYASGADSAAASAGYQLLQSGNQGLS 177


>tr|B3P3E1|B3P3E1_DROER GG22224 OS=Drosophila erecta GN=GG22224 PE=4
SV=1
Length = 213

Score = 35.0 bits (79), Expect = 1.9
Identities = 24/87 (27%), Positives = 34/87 (39%), Gaps = 11/87 (12%)
Frame = +2

Query: 122 ELRDYHSFLESHSDDLGDCYHAY---------DLPTH--HSMAHIHLFHDPHY*MMPYHN 268
E D+H ESH G +H Y + P + H H HL H PYH+
Sbjct: 88 ESHDHHQLSESHPPMHGSPHHHYYGSHPQQQLEAPVYGIHGSDHRHLIHG-----SPYHH 142

Query: 269 GALSCPFQA*HLQKFHNIHF*NLFQTC 349
L P+ +Q H +H + + C
Sbjct: 143 NHLEAPYHG--IQGTHGVHHLHHHRNC 167


>tr|A4ULZ0|A4ULZ0_DROSE Chorion protein 38 (Fragment) OS=Drosophila
sechellia GN=cp38 PE=4 SV=1
Length = 306

Score = 35.0 bits (79), Expect = 1.9
Identities = 29/107 (27%), Positives = 45/107 (42%), Gaps = 1/107 (0%)
Frame = -2

Query: 407 PRLHAAEPPRVDANIRIPENRFERGFRSEYYGT-SEDARLGMDMTKHHYGMASFNSVGHG 231
PR EP V+ ++ P ++ + YG S+ G H +G + GHG
Sbjct: 169 PRRVKVEPVFVNV-VKPPAEKYFVNENKQGYGQGSQSHGHGHGHGGHGHGHSGHGHGGHG 227

Query: 230 RGEYEPLNDALGDHMHGNNLPSHLNATQGSYDSHGAQVFVSNSQKLS 90
G + P G H G LP++ + + S G Q+ S +Q LS
Sbjct: 228 AGPHGP-----GPHDGGRGLPAYASGADSAAASAGYQLLQSGNQGLS 269


>tr|Q7RIQ7|Q7RIQ7_PLAYO Putative uncharacterized protein PY03560
OS=Plasmodium yoelii yoelii GN=PY03560 PE=4 SV=1
Length = 575

Score = 34.7 bits (78), Expect = 2.4
Identities = 28/89 (31%), Positives = 44/89 (49%), Gaps = 9/89 (10%)
Frame = -2

Query: 284 DMTKHHYGMASFNSVGHGRGEYEPLNDALGDHMHGNNLP-------SHLNATQG--SYDS 132
+M K + S+NSV HG YEP + + ++ + NN+P S LN Q +YD
Sbjct: 33 EMVKPYNMNMSYNSVTHGNNFYEPTRNFVNNNYNINNVPINNNNNVSQLNNYQNGMTYD- 91

Query: 131 HGAQVFVSNSQKLSTAGVYNALGVDEQCY 45
Q F+++S+ + G YN +E Y
Sbjct: 92 ---QYFMNSSEYEN--GTYNINNNNEHYY 115


>tr|B3DNM9|B3DNM9_DROME TA01446p (Fragment) OS=Drosophila
melanogaster GN=CG11213-RA PE=2 SV=1
Length = 331

Score = 34.3 bits (77), Expect = 3.2
Identities = 29/107 (27%), Positives = 45/107 (42%), Gaps = 1/107 (0%)
Frame = -2

Query: 407 PRLHAAEPPRVDANIRIPENRFERGFRSEYYGT-SEDARLGMDMTKHHYGMASFNSVGHG 231
PR EP V+ ++ P ++ + YG S+ G H +G + GHG
Sbjct: 194 PRRVKVEPVFVNV-VKPPAEKYFVNENKQGYGQGSQSHGHGHGHGGHGHGHSGHGHGGHG 252

Query: 230 RGEYEPLNDALGDHMHGNNLPSHLNATQGSYDSHGAQVFVSNSQKLS 90
G + P G H G LP++ + + S G Q+ S +Q LS
Sbjct: 253 AGPHGP-----GPHDGGRALPAYASGADSAAASAGYQLLQSGNQGLS 294


>tr|B3DNC0|B3DNC0_DROME IP19609p (Fragment) OS=Drosophila
melanogaster GN=CG11213-RA PE=2 SV=1
Length = 331

Score = 34.3 bits (77), Expect = 3.2
Identities = 29/107 (27%), Positives = 45/107 (42%), Gaps = 1/107 (0%)
Frame = -2

Query: 407 PRLHAAEPPRVDANIRIPENRFERGFRSEYYGT-SEDARLGMDMTKHHYGMASFNSVGHG 231
PR EP V+ ++ P ++ + YG S+ G H +G + GHG
Sbjct: 194 PRRVKVEPVFVNV-VKPPAEKYFVNENKQGYGQGSQSHGHGHGHGGHGHGHSGHGHGGHG 252

Query: 230 RGEYEPLNDALGDHMHGNNLPSHLNATQGSYDSHGAQVFVSNSQKLS 90
G + P G H G LP++ + + S G Q+ S +Q LS
Sbjct: 253 AGPHGP-----GPHDGGRALPAYASGADSAAASAGYQLLQSGNQGLS 294


>tr|B3DNA9|B3DNA9_DROME IP19109p (IP19503p) (Fragment) OS=Drosophila
melanogaster GN=CG11213-RA PE=2 SV=1
Length = 331

Score = 34.3 bits (77), Expect = 3.2
Identities = 29/107 (27%), Positives = 45/107 (42%), Gaps = 1/107 (0%)
Frame = -2

Query: 407 PRLHAAEPPRVDANIRIPENRFERGFRSEYYGT-SEDARLGMDMTKHHYGMASFNSVGHG 231
PR EP V+ ++ P ++ + YG S+ G H +G + GHG
Sbjct: 194 PRRVKVEPVFVNV-VKPPAEKYFVNENKQGYGQGSQSHGHGHGHGGHGHGHSGHGHGGHG 252

Query: 230 RGEYEPLNDALGDHMHGNNLPSHLNATQGSYDSHGAQVFVSNSQKLS 90
G + P G H G LP++ + + S G Q+ S +Q LS
Sbjct: 253 AGPHGP-----GPHDGGRALPAYASGADSAAASAGYQLLQSGNQGLS 294


>tr|A4ULY9|A4ULY9_DROSI Chorion protein 38 (Fragment) OS=Drosophila
simulans GN=cp38 PE=4 SV=1
Length = 306

Score = 34.3 bits (77), Expect = 3.2
Identities = 29/107 (27%), Positives = 45/107 (42%), Gaps = 1/107 (0%)
Frame = -2

Query: 407 PRLHAAEPPRVDANIRIPENRFERGFRSEYYGT-SEDARLGMDMTKHHYGMASFNSVGHG 231
PR EP V+ ++ P ++ + YG S+ G H +G + GHG
Sbjct: 169 PRRVKVEPVFVNV-VKPPAEKYFVNENKQGYGQGSQSHGHGHGHGGHGHGHSGHGHGGHG 227

Query: 230 RGEYEPLNDALGDHMHGNNLPSHLNATQGSYDSHGAQVFVSNSQKLS 90
G + P G H G LP++ + + S G Q+ S +Q LS
Sbjct: 228 AGPHGP-----GPHDGGRALPAYASGADSAAASAGYQLLQSGNQGLS 269