BP918497
Clone id YMU001_000114_B11
Library
Length 498
Definition Adiantum capillus-veneris mRNA. clone: YMU001_000114_B11.
Accession
Tissue type prothallium
Developmental stage -
Contig ID -
Sequence
CAGTAACTCAGCCAATTATCACCATCTAAATCACACCCTTGTTTGAAGCATTCAAGAGAC
TCTTTTGAATAACAGCTTCAGAGGCTCATTGTTGATGCAAGCAAGAAGTGCAAAAACACT
TTCCTGCTTCAAAGAAGAGCCAAAACAGTTTCCTTCTTGAAAGATAACAGCAATGTGCCA
AGCTGCACAGCCATATGGCCTTCTAGGCCTCCTCAGATTCCGTGTGGACTCCCACCCTGA
GCCATGGCACCCATGATCTGCTATATGCACCCTAACTGCTAAAGACATTTGTGCTCCATT
GTCCTGCTCCAGCACACGATCCCCACCTGCCATGAGTGCTCCATTGTCCTGTTTCTAAAG
ATGACGCAGCACCTTTCCCCTCTCCCCCCAAATTCTAATTCTGATGTACAAAGATGACCT
AATGGTGAGGAAGAATCAAGACTTCAAATATTGCGTTTTCTCCTCGCCAAATCTTGTACA
GCTATTTTTGAGCTCGTC
■■Homology search results ■■ -
sp_hit_id Q9Y493
Definition sp|Q9Y493|ZAN_HUMAN Zonadhesin OS=Homo sapiens
Align length 76
Score (bit) 31.2
E-value 2.8
Report
BLASTX 2.2.19 [Nov-02-2008]


Reference: Altschul, Stephen F., Thomas L. Madden, Alejandro A. Schaffer,
Jinghui Zhang, Zheng Zhang, Webb Miller, and David J. Lipman (1997),
"Gapped BLAST and PSI-BLAST: a new generation of protein database search
programs", Nucleic Acids Res. 25:3389-3402.

Query= BP918497|Adiantum capillus-veneris mRNA, clone:
YMU001_000114_B11.
(498 letters)

Database: uniprot_sprot.fasta
412,525 sequences; 148,809,765 total letters

Searching..................................................done



Score E
Sequences producing significant alignments: (bits) Value

sp|Q9Y493|ZAN_HUMAN Zonadhesin OS=Homo sapiens GN=ZAN PE=2 SV=3 31 2.8
sp|P42827|T2C1_COREQ Type-2 restriction enzyme CeqI OS=Corynebac... 31 3.6
sp|P46494|Y656A_HAEIN Uncharacterized protein HI0656.1 OS=Haemop... 30 4.8
sp|Q54FD8|PSID_DICDI Protein psiD OS=Dictyostelium discoideum GN... 30 6.1

>sp|Q9Y493|ZAN_HUMAN Zonadhesin OS=Homo sapiens GN=ZAN PE=2 SV=3
Length = 2812

Score = 31.2 bits (69), Expect = 2.8
Identities = 24/76 (31%), Positives = 30/76 (39%), Gaps = 16/76 (21%)
Frame = +2

Query: 173 MCQAAQPYGLLGLLRFRVDSHPE---PWHP*S--AICTLTAKDICAPLS----------- 304
+CQ +P GL G LR R+ HP WHP A C T+ I L
Sbjct: 2616 LCQPGRPRGLRGPLRGRLRQHPRLCLQWHPEPPLADCGCTSNGIYYQLGSSFLTEDCSQR 2675

Query: 305 CSSTRSPPAMSAPLSC 352
C+ S + P SC
Sbjct: 2676 CTCASSRILLCEPFSC 2691


>sp|P42827|T2C1_COREQ Type-2 restriction enzyme CeqI
OS=Corynebacterium equii GN=ceqIR PE=4 SV=1
Length = 270

Score = 30.8 bits (68), Expect = 3.6
Identities = 12/30 (40%), Positives = 19/30 (63%)
Frame = -3

Query: 163 LSRRKLFWLFFEAGKCFCTSCLHQQ*ASEA 74
L RR F+L+F KCFC +H++ ++A
Sbjct: 218 LRRRAWFFLWFNRSKCFCVGSIHKRNKNKA 247


>sp|P46494|Y656A_HAEIN Uncharacterized protein HI0656.1
OS=Haemophilus influenzae GN=HI0656.1 PE=4 SV=1
Length = 178

Score = 30.4 bits (67), Expect = 4.8
Identities = 12/40 (30%), Positives = 18/40 (45%)
Frame = +1

Query: 106 KCKNTFLLQRRAKTVSFLKDNSNVPSCTAIWPSRPPQIPC 225
+CK L+ RR + N P C P++P +PC
Sbjct: 106 ECKTGHLISRRGRQGKIFYGCDNFPKCKFSLPAKPYSVPC 145


>sp|Q54FD8|PSID_DICDI Protein psiD OS=Dictyostelium discoideum
GN=psiD PE=3 SV=1
Length = 504

Score = 30.0 bits (66), Expect = 6.1
Identities = 10/32 (31%), Positives = 18/32 (56%)
Frame = +2

Query: 257 SAICTLTAKDICAPLSCSSTRSPPAMSAPLSC 352
+A+ T D+C P C+ +PP + P++C
Sbjct: 343 NAVDTCITNDLCFPRECNPRGNPPCLINPINC 374


tr_hit_id A8M0V1
Definition tr|A8M0V1|A8M0V1_SALAI Acyl-CoA dehydrogenase domain protein OS=Salinispora arenicola (strain CNS-205)
Align length 68
Score (bit) 35.8
E-value 1.2
Report
BLASTX 2.2.19 [Nov-02-2008]


Reference: Altschul, Stephen F., Thomas L. Madden, Alejandro A. Schaffer,
Jinghui Zhang, Zheng Zhang, Webb Miller, and David J. Lipman (1997),
"Gapped BLAST and PSI-BLAST: a new generation of protein database search
programs", Nucleic Acids Res. 25:3389-3402.

Query= BP918497|Adiantum capillus-veneris mRNA, clone:
YMU001_000114_B11.
(498 letters)

Database: uniprot_trembl.fasta
7,341,751 sequences; 2,391,615,440 total letters

Searching..................................................done



Score E
Sequences producing significant alignments: (bits) Value

tr|A8M0V1|A8M0V1_SALAI Acyl-CoA dehydrogenase domain protein OS=... 36 1.2
tr|A9TCI0|A9TCI0_PHYPA Predicted protein OS=Physcomitrella paten... 35 2.0
tr|Q9F3J1|Q9F3J1_STRCO Putative uncharacterized protein SCO5274 ... 34 3.4
tr|Q9C2H5|Q9C2H5_NEUCR Related to flavin-containing monooxygenas... 33 7.4
tr|A5UE76|A5UE76_HAEIE Putative uncharacterized protein OS=Haemo... 33 9.7
tr|B0SWG0|B0SWG0_CAUSK Peptidase M23B OS=Caulobacter sp. (strain... 33 9.8

>tr|A8M0V1|A8M0V1_SALAI Acyl-CoA dehydrogenase domain protein
OS=Salinispora arenicola (strain CNS-205) GN=Sare_3819
PE=4 SV=1
Length = 667

Score = 35.8 bits (81), Expect = 1.2
Identities = 27/68 (39%), Positives = 35/68 (51%), Gaps = 4/68 (5%)
Frame = -3

Query: 415 IFVHQN*NLGGEGKG---AASSLETGQWSTHGRWGSCAGAGQWSTNVFSS*GAYSRSWVP 245
+FV +GGEGKG A ++L TG+ S C GAG+W+ NV +S V
Sbjct: 294 VFVPNENVIGGEGKGLKIALTTLNTGRLSLPAM---CVGAGKWALNVARE---WSAERVQ 347

Query: 244 WLR-VGVH 224
W R VG H
Sbjct: 348 WGRSVGDH 355


>tr|A9TCI0|A9TCI0_PHYPA Predicted protein OS=Physcomitrella patens
subsp. patens GN=PHYPADRAFT_90970 PE=4 SV=1
Length = 359

Score = 35.0 bits (79), Expect = 2.0
Identities = 18/46 (39%), Positives = 27/46 (58%), Gaps = 2/46 (4%)
Frame = -1

Query: 261 ADHGCHGSGWESTRNLRRPR--RPYGCAAWHIAVIFQEGNCFGSSL 130
ADHG GS + T + RPR P+ C +A++F EG+ G+S+
Sbjct: 173 ADHGIQGSHRQGTLRVHRPRWCNPFICVPGTLALLFLEGDGEGASV 218


>tr|Q9F3J1|Q9F3J1_STRCO Putative uncharacterized protein SCO5274
OS=Streptomyces coelicolor GN=SCO5274 PE=4 SV=1
Length = 541

Score = 34.3 bits (77), Expect = 3.4
Identities = 17/36 (47%), Positives = 18/36 (50%), Gaps = 7/36 (19%)
Frame = -3

Query: 388 GGEGKGAASSLETGQWSTH-------GRWGSCAGAG 302
G G A + TG WSTH G WGS AGAG
Sbjct: 100 GARGTSAVADAPTGAWSTHAADDAPTGAWGSRAGAG 135


>tr|Q9C2H5|Q9C2H5_NEUCR Related to flavin-containing monooxygenase
(Putative uncharacterized protein) OS=Neurospora crassa
GN=93G11.170 PE=4 SV=1
Length = 477

Score = 33.1 bits (74), Expect = 7.4
Identities = 17/40 (42%), Positives = 21/40 (52%)
Frame = +1

Query: 172 NVPSCTAIWPSRPPQIPCGLPP*AMAPMICYMHPNC*RHL 291
+VP +A P PP P G PP +PM +H N RHL
Sbjct: 62 HVPQVSAFCPPDPPLHPEGKPPVFPSPMYEVLHTNIPRHL 101


>tr|A5UE76|A5UE76_HAEIE Putative uncharacterized protein
OS=Haemophilus influenzae (strain PittEE)
GN=CGSHiEE_08910 PE=4 SV=1
Length = 178

Score = 32.7 bits (73), Expect = 9.7
Identities = 13/43 (30%), Positives = 20/43 (46%)
Frame = +1

Query: 97 ASKKCKNTFLLQRRAKTVSFLKDNSNVPSCTAIWPSRPPQIPC 225
A +CK +L+ RR + N P C P++P +PC
Sbjct: 103 ACPECKTGYLISRRGRQGKIFYGCDNFPKCKFSLPAKPYSVPC 145


>tr|B0SWG0|B0SWG0_CAUSK Peptidase M23B OS=Caulobacter sp. (strain
K31) GN=Caul_1027 PE=4 SV=1
Length = 464

Score = 32.7 bits (73), Expect = 9.8
Identities = 18/45 (40%), Positives = 23/45 (51%)
Frame = -3

Query: 358 LETGQWSTHGRWGSCAGAGQWSTNVFSS*GAYSRSWVPWLRVGVH 224
LE +WS +G W +GQW T G SR + P +R GVH
Sbjct: 332 LEARRWSGYGNWLRIRHSGQWDTGY----GHISR-YAPGIRPGVH 371